KEGG   Achromobacter xylosoxidans A8: AXYL_02895Help
Entry
AXYL_02895        CDS       T01341                                 

Gene name
folE2
Definition
GTP cyclohydrolase 2 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:axy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3096056..3096601)
Genome map
AA seq 181 aa AA seqDB search
MSLEKHYTAILEQLGEDPSREGLADTPARAAKAMRHLCRGYDQNLDEIVNGALFTSDTRE
IVLVKNIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVEMYARRLQIQENLSRQ
VAEAVQSVTDAAGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFHDNPSTRAEFLSLI
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcattggaaaagcactacaccgccattctcgaacaactaggggaagatccgtcccgc
gaagggctggccgacacgccggcgcgcgcggccaaggccatgcgccacctgtgccgcggc
tacgaccagaacctggacgaaatcgtcaacggcgcgctgttcacctccgacacgcgcgag
attgtgctggtcaagaacatcgagctgtactcgctctgtgagcaccacatgctgcccttc
atcggcaaggcgcatgtggcctacctgcccaacggcaaggtgctgggcctgtccaaggtc
gcgcgcatcgtcgagatgtacgcgcgccgcctgcagatccaggagaacctcagccgccag
gtggcagaggccgtgcagtccgtgaccgacgccgccggcgtggccgtggtcatcgaagcg
cagcacatgtgcatgatgatgcgcggcgtggaaaagcagaattcgtccatggtgacctcc
gtcatgctgggcgaattccacgacaacccctcgacccgggccgagtttctgagcctcatc
cgctag

DBGET integrated database retrieval system