KEGG   Achromobacter xylosoxidans A8: AXYL_03242Help
Entry
AXYL_03242        CDS       T01341                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXYL_03242 (glgB)
Enzymes [BR:axy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AXYL_03242 (glgB)
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXYL_03242 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3489248..3491440
Genome map
AA seq 730 aa AA seqDB search
MNQDMRAGAVTADPAELAALACGLHNDPYAFLGPHDGELRVYAPGAQRVDALDAGGARTA
LREQGQGLFLGRVAHARTGDASSYRLAIQWPGAEQVTADPYAFGPLLNEETLEQLAQGSW
RDAGTALGARLMAVDGVAGLRCAVWAPNAQRVAVVGDFNAWDSRRHGMRLRHRAGVWEIF
IPGVRAGERYKFAITDRAGNQRLKADPLARRSEAPPATASVVEDPADYSWEDQAWMADRQ
ARQSPEAPLSIYEVHAGSWLPDDAGSNACIWDRLADKLPAYARAMGFSHVELLPVMEHPF
GGSWGYQPLGMFAPAARYGPPEAFARFVDRCHHAGIGVILDWVPAHFPDDAHGLARFDGS
ALYEYEDPREGYHPDWHTMVYNLGRTEVQAFMIASALHWLQRFHIDGLRVDAVASMLYRD
YSRQPGQWIPNRYGGRENLEAMQFLQALNGTVRQEVPDAIMVAEESTAWPGVTAPVAEGG
LGFHYKWNMGWMHDTLRYLSQDPVHRKHHHHDITFSMVYAYSERFILPLSHDEVVHGKGS
LLAKMPGDAAARLANLRAYLGFMWAHPGKKLLFMGGEMAQPREWNHDEPLDWELLDRPGH
LGMQRLVADLNGLYRALPALHAQDADPAGFAWTILDDRDNSVVAFVRSDGTHHVLAVANF
TPVARHDYRIGVPRAGRWTERLNTDATHYGGSGQGNQGGASTGEGASHGQPQALSLTLPP
LATLFLLYEG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggacatgcgcgccggagccgtcaccgccgatcccgccgaactggccgcgctg
gcttgcggcctgcacaacgatccctatgccttcctggggccgcacgatggcgagctgcgc
gtgtatgccccgggcgcgcagcgggtcgacgcgctggatgcgggaggcgccaggaccgcc
ctgcgagaacagggccagggactgttccttggacgcgtggcgcacgcccggacaggcgac
gcgagttcgtaccgcctggctatccaatggcccggcgccgagcaggtcaccgccgatccc
tatgcgttcggccccttgctgaatgaagagacgctggagcaactggcgcaaggttcatgg
cgcgacgccgggactgcgctcggcgcgcgactgatggcggtcgatggcgtggccggcctg
cgctgcgcggtgtgggcgccgaatgcgcaacgcgtcgccgtggtgggcgatttcaacgcc
tgggacagccgccggcacggcatgcggctgcggcaccgcgcgggcgtctgggagatcttc
atcccgggcgtgcgcgctggcgagcgctacaagttcgccatcaccgaccgcgccggcaat
cagcgtctcaaggccgatccgctggcgcggcgcagtgaagcgccgccagccactgcttcg
gtggtggaggatccagcagactattcgtgggaagaccaggcctggatggcggaccggcag
gcgcgccaatctccggaagcgccgctgtccatctatgaagtgcacgccggttcctggctg
cccgacgacgccggatccaacgcctgcatctgggaccgcctggccgacaagctgccggcc
tacgcccgcgccatgggtttcagccacgtggagctgctgcccgtcatggagcaccccttc
ggcggatcctggggctaccagcccctgggcatgttcgcacccgccgcccgttacgggccg
ccggaggcgttcgcccgcttcgtcgaccgctgccaccacgccggcatcggcgtcatcctg
gattgggtgcccgcgcactttcccgacgatgcgcacggcctggcccgcttcgacggcagc
gcgttgtacgagtacgaggatccgcgcgaaggctaccacccagactggcacaccatggtc
tacaacctgggacgcacggaggtgcaggcctttatgatcgccagcgcgctgcactggctg
cagcgcttccacatcgatggactgagggtcgacgcggtggcgtcgatgctgtaccgcgac
tacagccgccaaccgggacaatggatccccaaccgctacggcggccgcgaaaacctggag
gcgatgcagttcctgcaggcgctgaacggcaccgtgcggcaggaagtcccggacgccatc
atggtggccgaggaatccaccgcctggccgggcgtgaccgcgccggtcgccgagggcggc
ctgggctttcactacaagtggaacatgggctggatgcacgacaccttgcgctatctgtcc
caggacccggtgcaccgcaagcatcaccaccacgacatcaccttcagcatggtttacgcg
tacagcgagcgtttcatcctgccgctgtcgcacgacgaagtggtgcacggcaaaggctcg
ctgctggccaagatgccgggcgatgcggccgccaggctcgccaacctgcgcgcctatctg
ggcttcatgtgggcccatccgggcaagaagctgctgttcatgggcggcgagatggcccag
ccgcgggagtggaaccatgacgagccgcttgattgggaattgctggaccgtcccggccac
ctgggcatgcagcgactggtcgccgacctgaacggcctgtaccgcgcgctgccagcgctg
catgcgcaggatgccgacccagccggcttcgcctggaccatcctggacgaccgcgataac
agcgtggtcgcgttcgtccgcagcgacggcacgcaccatgtgctcgcggtcgcaaatttc
acgcccgtggcgcgccatgactaccgcataggcgtgccgcgcgccggccgctggacggaa
aggctgaacaccgatgccacgcactacggcggctcgggccagggcaaccagggcggcgcc
agcaccggagaaggcgcgtcccacggccagccccaggccttgtcgctcaccttgccgcct
ctggccaccctctttttgctctacgaaggctga

DBGET integrated database retrieval system