KEGG   Achromobacter xylosoxidans A8: AXYL_03296Help
Entry
AXYL_03296        CDS       T01341                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:axy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:axy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3552719..3553681
Genome map
AA seq 320 aa AA seqDB search
MHPTGARDLQNTANLPQHITLIGAPTDIGAGARGASMGPEALRVADLGPVIEAQGFQVTD
RGNLYGPANPWLPPVDGYRHLDEVAAWNRAVHDAVYEELSQGRLPILLGGDHCLGIGSIS
AVARHCRAVGKKLRVLWLDAHADFNTNALTPTGNIHGMPVACLCGYGPAQITGLSGQTPD
IEPGWVRQIGIRSVDQGEKRLVHEAGLEVFDMRYLDEMGMRATMEAALAGLDEDTHLHVS
FDVDFLDPEIAPGVGTTVAGGPTYREAQLCMEMIADTGLMRSLDVVELNPAFDVRNKTAE
LAVDLIESLFGKSTLMRRGS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccaccggagcccgcgacttgcagaacaccgccaacctgccccaacacatcacc
ctgatcggcgcgcccacagacatcggcgccggcgcgcgcggcgcctccatgggtccggag
gccctgcgcgtggcggacctgggtccggtcatcgaggcccagggctttcaggtcaccgac
cgcggcaacctctacgggcccgccaatccctggctgccacccgtggacggctaccgccat
ctggacgaagtggccgcgtggaaccgagctgtgcacgacgccgtctacgaggaactcagc
cagggccgcctgcccatcctgctgggcggcgaccactgcctgggcataggctcgatcagc
gcggtggcgcgccactgccgcgcagttggcaagaagctgcgggtgctgtggctggacgcc
catgccgatttcaataccaacgccttgacgcccaccggcaacatccatggcatgcccgtg
gcctgcctgtgcggctatggtccggcgcagatcaccggactgtccggccagactcccgac
atcgaaccgggctgggtgcggcagatcggcatacgcagcgtggaccagggcgaaaagcgc
ctggtccacgaagccggcctggaagtcttcgacatgcgctacctggacgaaatgggcatg
cgcgccaccatggaagcggccttggcggggctggacgaggacacccatctgcacgtgagc
ttcgacgtggatttcctggatccggaaatcgcccccggcgtgggcaccaccgtggcgggc
ggcccgacctatcgcgaagcccagctctgcatggaaatgatcgccgataccggcctgatg
cgctcgctggacgtggtggagctgaacccggccttcgacgtgcgcaacaagaccgccgaa
ctggcggtggacctgatcgaaagcctgttcggcaagtccaccctgatgcgccgcggctcc
tga

DBGET integrated database retrieval system