KEGG   Achromobacter xylosoxidans A8: AXYL_03298Help
Entry
AXYL_03298        CDS       T01341                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein 6
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00071  Fatty acid degradation
axy00350  Tyrosine metabolism
axy00625  Chloroalkane and chloroalkene degradation
axy00626  Naphthalene degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_03298
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_03298
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXYL_03298
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXYL_03298
   00626 Naphthalene degradation
    AXYL_03298
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXYL_03298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ADP16618
UniProt: E3HGW8
Position
3555277..3556335
Genome map
AA seq 352 aa AA seqDB search
MKCYCVVNFREPLQEMNPPTPTPQGSQVLLKVRAAGVCHSDIHLWEGGYDLGQGRTLSLK
DRGVSLPLTMGHETVGAVVAAGPDAQGLPVDRNYLVYPWIGCGNCPPCQAGIENHCSAPA
CLGVHRAGGYADHILVPHPRYLIDIGDLDPAQIAPYACSGLTTYSALKKIGADVYRSHPV
VIFGAGGLGLMSLTLIKALGGAGAIVVDIDPAKRQAALEAGALAAIDGAAPDAAQQIIKA
AGGKPVQAAIDLVGAPATTSLAFDFLTKGGKLIIVGLFGGASSWPIALIPMKALSIVGSY
VGNLAELQELMELVRAGKVPPMPVHRHALAEADSVLASLRAGKVVGRAVLTN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctattgcgtcgtgaacttccgcgaacccctgcaggaaatgaacccgcccacc
ccgacgccgcaggggtcgcaggtgctgctgaaggtacgcgcagcgggcgtttgccacagc
gatatccacttgtgggaaggcggctacgacctgggccagggccgcacgctgtcgctgaag
gaccgcggcgtctcgctgcccctgaccatgggccacgaaaccgtgggcgccgtggtcgcc
gctggccccgacgcccaggggctgccggtcgaccgcaactacctggtctatccctggatc
ggctgcggcaactgcccgccttgccaggccggcatcgaaaaccattgctccgcgcccgcc
tgcctgggcgtgcaccgcgccggcggctacgccgaccacatcctggtgccgcacccgcgc
tacctgatcgacatcggcgacctcgatcccgcgcagatcgccccctatgcctgctccggg
ctcaccacctattccgcgctgaagaagatcggcgccgacgtgtaccgctcgcaccccgtg
gtcatcttcggcgccggcggcctgggcctgatgagcctcacgctgatcaaggccctgggc
ggtgcgggcgccatcgtggtcgacatcgacccggccaagcgccaggccgctttggaagcc
ggcgccctggccgccatcgacggtgcggcacccgacgccgcgcagcagatcatcaaggca
gccggcggcaagcccgtgcaggccgccatcgatctggtcggcgcgcccgcgaccacctcg
ctggccttcgactttctgaccaagggcggcaagctgatcatcgtgggcctgttcggcggc
gcctcgtcctggccgatcgcgctaatccccatgaaggccctgtccatcgtcggcagctac
gtcggcaacctggccgaactgcaggaactgatggaactggtgcgggccggcaaggtgccg
cccatgccggtgcaccgccatgcgctggccgaagccgacagcgtgctggcgtcgctgcgg
gccggcaaggtggtgggccgcgcggtgctgacgaactga

DBGET integrated database retrieval system