KEGG   Achromobacter xylosoxidans A8: AXYL_03298Help
Entry
AXYL_03298        CDS       T01341                                 

Definition
zinc-binding dehydrogenase family protein 6
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXYL_03298
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_03298
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_03298
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXYL_03298
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXYL_03298
   00626 Naphthalene degradation
    AXYL_03298
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXYL_03298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3555277..3556335
Genome map
AA seq 352 aa AA seqDB search
MKCYCVVNFREPLQEMNPPTPTPQGSQVLLKVRAAGVCHSDIHLWEGGYDLGQGRTLSLK
DRGVSLPLTMGHETVGAVVAAGPDAQGLPVDRNYLVYPWIGCGNCPPCQAGIENHCSAPA
CLGVHRAGGYADHILVPHPRYLIDIGDLDPAQIAPYACSGLTTYSALKKIGADVYRSHPV
VIFGAGGLGLMSLTLIKALGGAGAIVVDIDPAKRQAALEAGALAAIDGAAPDAAQQIIKA
AGGKPVQAAIDLVGAPATTSLAFDFLTKGGKLIIVGLFGGASSWPIALIPMKALSIVGSY
VGNLAELQELMELVRAGKVPPMPVHRHALAEADSVLASLRAGKVVGRAVLTN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctattgcgtcgtgaacttccgcgaacccctgcaggaaatgaacccgcccacc
ccgacgccgcaggggtcgcaggtgctgctgaaggtacgcgcagcgggcgtttgccacagc
gatatccacttgtgggaaggcggctacgacctgggccagggccgcacgctgtcgctgaag
gaccgcggcgtctcgctgcccctgaccatgggccacgaaaccgtgggcgccgtggtcgcc
gctggccccgacgcccaggggctgccggtcgaccgcaactacctggtctatccctggatc
ggctgcggcaactgcccgccttgccaggccggcatcgaaaaccattgctccgcgcccgcc
tgcctgggcgtgcaccgcgccggcggctacgccgaccacatcctggtgccgcacccgcgc
tacctgatcgacatcggcgacctcgatcccgcgcagatcgccccctatgcctgctccggg
ctcaccacctattccgcgctgaagaagatcggcgccgacgtgtaccgctcgcaccccgtg
gtcatcttcggcgccggcggcctgggcctgatgagcctcacgctgatcaaggccctgggc
ggtgcgggcgccatcgtggtcgacatcgacccggccaagcgccaggccgctttggaagcc
ggcgccctggccgccatcgacggtgcggcacccgacgccgcgcagcagatcatcaaggca
gccggcggcaagcccgtgcaggccgccatcgatctggtcggcgcgcccgcgaccacctcg
ctggccttcgactttctgaccaagggcggcaagctgatcatcgtgggcctgttcggcggc
gcctcgtcctggccgatcgcgctaatccccatgaaggccctgtccatcgtcggcagctac
gtcggcaacctggccgaactgcaggaactgatggaactggtgcgggccggcaaggtgccg
cccatgccggtgcaccgccatgcgctggccgaagccgacagcgtgctggcgtcgctgcgg
gccggcaaggtggtgggccgcgcggtgctgacgaactga

DBGET integrated database retrieval system