KEGG   Achromobacter xylosoxidans A8: AXYL_03364Help
Entry
AXYL_03364        CDS       T01341                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00230  Purine metabolism
axy01100  Metabolic pathways
Module
axy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AXYL_03364 (gmk)
Enzymes [BR:axy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AXYL_03364 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 ABC_tran AAA_22 AAA_16 MMR_HSR1 RsgA_GTPase AAA_18 DUF815 AAA_29 Viral_helicase1 AAA
Motif
Other DBs
NCBI-ProteinID: ADP16684
UniProt: E3HHY4
Position
3624041..3624673
Genome map
AA seq 210 aa AA seqDB search
MSANPGNVFMVVAPSGAGKSSLVKALLQQDPSILLSISCTTRAPRPGEEDGREYRFVSAD
EFKLLREGNNLLEWAEVHGNFYGTPRDRIDEATRAGRDVLLEIDWQGARQVKQRFPGAIG
VFVLPPSIDELESRLKARGQDAPQVIARRLMAAGGEIAHAPECEYVIINQEFSVALSELT
QIVSAARLRFSSQAARHSQLFSQLGIPAEH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaatcccggaaacgtcttcatggtcgtcgcgcccagcggcgccggcaagtcc
agcctggtcaaggccttgctccagcaagacccctccatcctgctctccatttcctgcacc
acccgcgcgccccgccccggcgaggaagacggccgcgaataccgcttcgtgtcggcggac
gagttcaagctcctgcgcgaaggcaacaatctgctggaatgggccgaagtgcacggcaat
ttctacggcacgccgcgagaccgcatcgacgaagccacccgcgccggccgcgacgtgctg
ctggaaatcgactggcaaggcgcgcgccaggtgaagcagcgctttcccggcgcgatcggc
gtgttcgtgctgccgccgtccatcgatgaactcgaaagccggctcaaggcgcgcggccag
gatgcgccccaggtgatcgcgcgccgcctgatggccgcgggcggcgaaatcgcccacgcg
cctgaatgcgaatatgttattattaatcaagaatttagcgtggccttgtcggaactgact
caaatagttagcgccgcgcggctgcgcttttcgtctcaggccgcccgccacagccagttg
ttctcgcaacttggcatcccggccgagcactga

DBGET integrated database retrieval system