KEGG   Achromobacter xylosoxidans A8: AXYL_03399Help
Entry
AXYL_03399        CDS       T01341                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AXYL_03399
Enzymes [BR:axy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AXYL_03399
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AXYL_03399
Lipid biosynthesis proteins [BR:axy01004]
 Fatty acid synthase
  Component type
   AXYL_03399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3662530..3663177
Genome map
AA seq 215 aa AA seqDB search
MRLFSRLLLVTAVATAIMAPAHAQTASAAQGSAPRTVLVLGDSLSAEYGIKRGTGWVPLL
SARVAEQYPKYQVVNASISGDTTSGGVARLPALLRQHAPAVVVLELGSNDALRGLPLNMT
EQNLRTMAQTARKADAEVLIVGMQIPPNYGRDYTQRFAQVFPTVAKDENARLVPFLMEGI
ATNRAMFQADGIHPNEDAQPLLLDNVWPTLRPLLN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctattttcccgtctgctactcgtgaccgccgtggcgaccgccatcatggcgccc
gcccacgctcagaccgcctcggccgcccagggttccgcgccacgaaccgtattggtcctg
ggcgacagcctgtcggccgaatacggcatcaagcgcggcaccggctgggtgccgctgctc
tcggcccgcgtagcggaacaataccccaagtaccaggtcgtcaacgccagcatcagcggc
gacacgaccagcggcggcgtggcccgcctgcctgccctgctgcgccagcatgcgccggcg
gtggtggtgctggagctgggctcgaacgacgccctgcgcggcctgcccctgaacatgacc
gagcagaacctgcgcaccatggcccagaccgcccgcaaggccgacgccgaagtcctgatc
gtcggcatgcagatcccgcccaattacggccgggactacacccagcgattcgcccaggtg
ttccccacggtcgccaaagacgaaaacgcccggctcgtgcccttcctgatggaaggtatc
gcaacgaaccgggcgatgttccaggccgacggcatccatccgaacgaggatgcccagcct
cttttgctggacaacgtgtggccgacgctgcggccactgttgaactga

DBGET integrated database retrieval system