KEGG   Achromobacter xylosoxidans A8: AXYL_03415Help
Entry
AXYL_03415        CDS       T01341                                 

Gene name
pcm2
Definition
methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AXYL_03415 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3679440..3680264)
Genome map
AA seq 274 aa AA seqDB search
MRKRVSQPDVSQPVSGRTGPVRYDSGRLSPGVTPANSNTRISAATLQRQTQAPTPASGSN
LGLNSDRLRQAMVERLRAQGITDERVLNAMGAVPRHLFVDEALASRAYEDAALPIGHSQT
ISQPWVVARMIAAACDDRTPTRVLEVGAGCGYQAAVLAQFVREVHTIERIRGLYELAREH
LRALRLTTRIRLIYGDGMLGLPGVAPFDAIVVAAAGLAIPQALLSQLAPGGRLIAPEGGA
NQRLVLIERTGAASWKRTELEAVRFVPLRAGIQS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacgcgtaagccaaccggatgtgagccagcccgtgtccgggcgcaccggcccg
gtgcgctacgactcgggccggctcagtcctggcgtcacgcccgccaacagcaatacgcgc
atttccgcggccacgctgcaacgccagacgcaggcgccgacgccggcgtccggcagcaac
ctgggcctgaactccgaccgcctgcgccaggccatggtggaacgcctgcgggcgcagggc
attaccgacgaacgcgtgctcaacgccatgggcgccgtgccgcgccatctgttcgtcgac
gaggcgctggccagccgcgcctacgaagacgcggcgctgcccatcggccattcgcaaacc
atttcgcaaccctgggtggtggcgcgcatgatcgccgctgcctgcgacgaccgcacgccc
acccgtgtgctggaagtcggcgcgggttgcggctaccaggcagcggtgctcgcgcagttc
gtgcgcgaggtccacaccatcgaacgcatccgcggactgtatgagttggcgcgcgagcat
ctgcgcgccttgcggctcaccacgaggatccgtttgatctacggcgacggcatgctgggc
ctgcccggcgtggcgccgttcgatgctatcgttgtggctgccgctggccttgccatcccg
caggcgctgctgtctcagctcgcgccgggtggccgcctgatcgctcctgaagggggcgcc
aaccagcgcctggttctcatcgaacgcacaggcgcggccagctggaaacgcaccgaatta
gaggccgtgcgctttgtgccgctacgggccggaatacaatcttga

DBGET integrated database retrieval system