KEGG   Achromobacter xylosoxidans A8: AXYL_03673Help
Entry
AXYL_03673        CDS       T01341                                 

Gene name
cheB2
Definition
chemotaxis-specific methylesterase 2 (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:axy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AXYL_03673 (cheB2)
Enzymes [BR:axy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AXYL_03673 (cheB2)
Two-component system [BR:axy02022]
 CheA family
  WspE-WspRF
   AXYL_03673 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947031..3948017)
Genome map
AA seq 328 aa AA seqDB search
MPMAVEVLRRAIALEPGLELAWVATNGQEAVDQCARDRPDVVLMDLIMPIMDGVEATRRI
MAETPCAIVVVTADVARHTSRVFDAMGHGALDAADTPVIGSGDMRTAAAPLLRKIRNVGW
LIGRYGKRPALTPVARPMQQADAKRLLVIGASAGGPPALAQLLKGIPPGFPAGIVLVQHV
DASFAAGMADWLNEQAPLPVRLVREGEWPEPGQILLAGTGDHLHMLADGTLRYTETPKES
LYRPSIDVFFHSVAQHWRGMAVGVLLTGMGQDGARGLKALRERGYLTIAQDQASSAVYGM
PKAAAAMQAAVEISPLDQIAPRLIQAFA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggcggtggaagtgctgcggcgcgcgatcgcgctggagccggggctggagctc
gcctgggtcgcgaccaacggccaggaggccgtggaccaatgcgctcgcgaccggccggac
gtggtgctgatggacctcatcatgcccatcatggatggcgtcgaagccacgcgccgcatc
atggctgaaacgccctgcgcgatcgtggtggtcacggccgacgtggcgcgccatacctcg
cgcgtgttcgacgccatgggccatggcgcgctggacgcggcggatacgccggtgatcggc
agcggcgacatgcgcacggcggcggcgccgctgctgcgcaagatccgcaacgtgggctgg
ctgatcggccgctacggcaagcggcctgcgcttacgccggtggcccggccgatgcagcag
gcggacgccaagcgcctgctggtcatcggcgcctcggccggcggcccgccggccctggcg
cagttgctgaaggggattccgccggggttcccagccggcatcgtgctggtgcagcacgtg
gacgcctcgttcgccgcgggtatggcggactggctcaacgagcaggcgccgctgccggta
aggctggtgcgcgagggcgagtggcccgagcccggccagatactgctggccggcaccggc
gaccatctccacatgctggcggacggcacgctgcgctacaccgaaacccccaaggaaagc
ctgtaccggccttccatcgatgtttttttccatagcgtggcgcagcactggcgcggcatg
gccgtcggcgtgctgctgacgggcatgggccaggacggcgcgcgcgggctgaaggcgctg
cgcgagcgcggctatctgacgattgcgcaggaccaggccagcagcgccgtctacggcatg
cccaaggccgcggccgccatgcaggcggccgtggaaatcagcccattggaccaaatcgct
ccccgcttgatccaggcctttgcctga

DBGET integrated database retrieval system