KEGG   Achromobacter xylosoxidans A8: AXYL_03827Help
Entry
AXYL_03827        CDS       T01341                                 

Definition
EPSP synthase family protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AXYL_03827
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXYL_03827
Enzymes [BR:axy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     AXYL_03827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107992..4109293
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGTPLRGRVIPSANKNAVLPVLCATLLTDQPLRLHGVPDITDVRKILDIFRTL
GSDVRLDESTRTLDLHHRDTAFDAASHRLPEEMRSSIMLVPPLLARFGVARLEDNVKGCT
LGVREIDPHVDIFRSFGGEVERASGSLLVRSSGPLKPTHHWLDYASVTTTENFVLCAAAA
QGESTLTNAASEPHVQEFCRFMAMMGADIDGIGTSRLTVRGGARLGGGEFTFEEDFHEIT
TFLALGAITGGDVVVRNSTPENFPLIDRTFAKFGVQIVHENGWSRALRSGPLKVQTPFTS
NVLTKVEAAPWPYFPVDLLPIFIALGVCAEGNAMFWNKVYDGALGWTGELSKFGAHVFSS
DPHRLITFGGRPLTPAVVESPYIIRVAIALFMIASSIDGRSEIRNATPIRRAHPRFVENL
RSLGVQVEWTSEE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacctcatcgtccacggcggcacccccttgcgcggccgcgtcatcccttcggcc
aacaagaacgcggtgctgccggtgctgtgcgccaccttgctgaccgaccagccgctgcgc
ctgcacggcgtgcccgacatcaccgacgtgcgcaagatcctggacatcttccgcaccctg
ggcagcgacgtccggctggacgaatccacccgcaccctggacctgcatcaccgcgacaca
gccttcgatgccgccagccaccggctgcccgaggaaatgcgctcgtccatcatgctggtg
ccgccgctgctggcgcgctttggcgtggcgcggctggaagacaacgtcaagggctgcacc
ttgggcgtgcgcgagatcgatccgcacgtggacatcttccgctccttcggcggcgaggtg
gaacgcgccagcggctcgctgctggtgcgcagcagcggccccttgaagccgacccaccac
tggctggactacgcctcggtgacgaccaccgagaacttcgtgctgtgcgcggccgccgcg
caaggcgaatcgaccctgacgaacgcggcctccgagccgcacgtacaggaattctgccgt
ttcatggcgatgatgggcgcggacatcgacggcatcggcacctcgcgcctgacggtgcgc
ggcggcgcccgcctgggcggcggcgaattcaccttcgaggaagacttccacgaaatcacc
acctttctcgcactgggcgcgatcacgggcggcgacgtggtggtgcgcaacagcacgccc
gagaacttcccgttgatcgaccgcaccttcgccaagttcggcgtgcagatcgtgcacgag
aacggctggtcgcgcgcgctgcgttccgggccgctgaaggtgcagacgcctttcaccagc
aatgtgctgaccaaggtcgaggcggcgccgtggccctatttcccggtggacctgctgccc
atcttcatcgcgctgggcgtgtgcgccgagggcaacgccatgttctggaacaaggtctac
gacggcgcgctgggctggaccggcgaactgtccaagttcggcgcgcacgtgttctcgtcc
gatccgcaccggctgatcacgttcggcggccggccgctgacgccggcggtggttgaaagc
ccctacatcatccgcgtcgccatcgcgctcttcatgatcgccagcagcatcgacggccgt
tcggaaatccgcaacgccacgccgatccgccgcgcccatccgcgcttcgtcgagaacctg
cgcagcctcggcgtgcaggtggaatggaccagcgaggagtaa

DBGET integrated database retrieval system