KEGG   Achromobacter xylosoxidans A8: AXYL_04074Help
Entry
AXYL_04074        CDS       T01341                                 

Definition
di-heme cytochrome C peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AXYL_04074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4352427..4353620
Genome map
AA seq 397 aa AA seqDB search
MAASRLSLLILGAALALATPLVRGDGGQARTPAAGPSGCHGPAGWDAACLRPHYSGPPAS
WPAPSIDPGVAWHEWSAVPPATSPPLSWTAANAGQQELAADVARPAVVTLGQMLFFDTAL
SRKGQVSCASCHLPQRAFTDGLALAVGEDRLMGRRRSTPLYAAPFAPRLFWDGRAASLKE
QVLGPIHDPREMNHDAGGAVARLLETEPYPAQFLLAFGAASAPQPPVDADRLARALAAYV
ATLRPEPTRFDEFLEGRSQALDDTELIGMHLFRTQARCMNCHSGPMLTDHQFHNIGLSFY
GRRNQDLGRYEATRDPADLGQFRTPSLRNVSRAGPWMHNGLFADLKGLLRMYNAGMGRDP
APADPPDPYAPRKSEHIRPLELSADEIDALLAFMRVL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaagtcggttatcgcttctgatcctgggcgcggcgctggcgctggcgacgcct
ttggttcgcggggacggcggccaggcccggacgccggccgccggcccgtccggctgccac
gggccggcgggctgggatgcggcttgcctgcggccgcactactcggggccacccgcgtcc
tggcccgcgccttccatcgatcccggcgtggcctggcacgaatggagtgcagtgccccct
gccaccagcccacccctgagttggaccgccgccaatgccggccagcaggagttggccgcc
gacgtcgcgcgtccggcggtcgtgactctggggcagatgctgttcttcgataccgcgctg
tcgcgcaaggggcaggtgtcctgtgcttcctgtcacctgccgcagcgcgccttcacggac
gggctcgcgctggccgtgggcgaagacagactgatgggcaggcggcgctcaaccccgctg
tacgcggctccgttcgcaccgcggctattctgggacgggcgcgccgccagcctgaaggag
caggtgctgggccccattcacgatccccgcgaaatgaaccatgacgccggcggcgccgtg
gcgcgcctgcttgaaaccgagccatatccggcgcagttcctgctggcgttcggcgcggcc
tctgcgccgcaaccgccggtggacgcggaccgcttggcgcgcgcgttggcggcctacgtc
gcaacattgcgtccggagccgacgcgctttgacgaattcctggaaggccgttcccaggcg
ctggacgataccgagttgatcggcatgcatctgttccgcacgcaggcgcgctgtatgaat
tgccacagcggcccgatgctgaccgaccatcaattccacaacatcggcctgtcgttctat
ggccgccgcaatcaggacctgggccgctacgaagcgacccgcgaccccgccgacctgggt
cagttccgcacgcccagcctgcgcaatgtgtcgcgcgccggcccttggatgcacaacggg
ctgttcgcggacctcaagggtttactgcggatgtacaacgccggcatgggccgcgatccg
gcgcccgccgatccgcccgatccgtacgcgccgcgcaagtccgagcacatccgaccgctg
gaactgagcgcggacgaaatcgacgccttgctggcgttcatgcgggtcttgtag

DBGET integrated database retrieval system