KEGG   Achromobacter xylosoxidans A8: AXYL_04213Help
Entry
AXYL_04213        CDS       T01341                                 

Definition
dioxygenase family protein 2 (EC:1.13.11.-)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:axy01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:axy00362]
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:axy00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:axy00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:axy00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4503702..4504574
Genome map
AA seq 290 aa AA seqDB search
MNPALPNAETALTDTVAAAYAQTPDPRLRQLMQSLVRHLHAFVADVEPTEAEWMAAIRFL
TETGQICDGVVRQEFILLSDTLGVSMLVDAINHRKPGQATESTVFGPFYIAGMPERAAGE
DMAQTPGAPALVHGYVRDTEGRPLAGAVLDVWQTAANGMYSGQDVEQPQGNLRGRYRSGE
DGYFAIRTILPVSYPIPGDGPVGRMMAATGRHVFRPAHLHFMIDAPGHQRLVTHLFNAGD
PYLESDAVFGVKPTLVLQYDRQHADSALGRRHGFDSDFHEGRYDFVLPRA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgccctgccgaacgctgaaaccgccttgaccgacacggtcgccgcagcctac
gcccagacgccggatcccaggctgcgccagttgatgcagtcgctggtgcggcacctgcac
gccttcgtcgccgacgtcgaacccaccgaggccgaatggatggcggcgatccggttcctg
accgaaaccggccagatctgtgacggcgtggtgcggcaggagttcatcctgctgtccgac
acgctgggcgtgtcgatgctggtggacgccatcaaccaccgcaaacccggccaggccacc
gaaagcacggtgttcggccccttctacatcgccggcatgcccgagcgcgcggccggcgag
gacatggcgcagacgcccggcgcgcccgcgctggtgcacgggtacgtccgcgacaccgaa
ggccggccgctggctggcgccgtgctcgacgtatggcagacggccgccaacggcatgtac
tcgggccaggacgtagagcagccgcaaggcaatctgcgaggacgttaccgcagcggcgag
gacggctacttcgcgatccgcaccatcctgccggtgtcctatccgatcccgggcgacggc
ccagtcggccgcatgatggcggcgacaggccgccacgtcttccggcccgcgcacctgcat
ttcatgatcgacgcgccgggacaccagcggctggtcacccatctgttcaatgccggggat
ccgtatctcgagtcggatgcggtgttcggcgtgaagcctacgctggtgctgcaatacgac
cggcaacacgcggattcggcgctgggccggcgccatggattcgattcggacttccacgag
gggcgctatgacttcgtgctgccccgcgcttga

DBGET integrated database retrieval system