KEGG   Achromobacter xylosoxidans A8: AXYL_04213Help
Entry
AXYL_04213        CDS       T01341                                 

Definition
dioxygenase family protein 2 (EC:1.13.11.-)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXYL_04213
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04213
   00364 Fluorobenzoate degradation
    AXYL_04213
   00361 Chlorocyclohexane and chlorobenzene degradation
    AXYL_04213
   00623 Toluene degradation
    AXYL_04213
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     AXYL_04213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4503702..4504574
Genome map
AA seq 290 aa AA seqDB search
MNPALPNAETALTDTVAAAYAQTPDPRLRQLMQSLVRHLHAFVADVEPTEAEWMAAIRFL
TETGQICDGVVRQEFILLSDTLGVSMLVDAINHRKPGQATESTVFGPFYIAGMPERAAGE
DMAQTPGAPALVHGYVRDTEGRPLAGAVLDVWQTAANGMYSGQDVEQPQGNLRGRYRSGE
DGYFAIRTILPVSYPIPGDGPVGRMMAATGRHVFRPAHLHFMIDAPGHQRLVTHLFNAGD
PYLESDAVFGVKPTLVLQYDRQHADSALGRRHGFDSDFHEGRYDFVLPRA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgccctgccgaacgctgaaaccgccttgaccgacacggtcgccgcagcctac
gcccagacgccggatcccaggctgcgccagttgatgcagtcgctggtgcggcacctgcac
gccttcgtcgccgacgtcgaacccaccgaggccgaatggatggcggcgatccggttcctg
accgaaaccggccagatctgtgacggcgtggtgcggcaggagttcatcctgctgtccgac
acgctgggcgtgtcgatgctggtggacgccatcaaccaccgcaaacccggccaggccacc
gaaagcacggtgttcggccccttctacatcgccggcatgcccgagcgcgcggccggcgag
gacatggcgcagacgcccggcgcgcccgcgctggtgcacgggtacgtccgcgacaccgaa
ggccggccgctggctggcgccgtgctcgacgtatggcagacggccgccaacggcatgtac
tcgggccaggacgtagagcagccgcaaggcaatctgcgaggacgttaccgcagcggcgag
gacggctacttcgcgatccgcaccatcctgccggtgtcctatccgatcccgggcgacggc
ccagtcggccgcatgatggcggcgacaggccgccacgtcttccggcccgcgcacctgcat
ttcatgatcgacgcgccgggacaccagcggctggtcacccatctgttcaatgccggggat
ccgtatctcgagtcggatgcggtgttcggcgtgaagcctacgctggtgctgcaatacgac
cggcaacacgcggattcggcgctgggccggcgccatggattcgattcggacttccacgag
gggcgctatgacttcgtgctgccccgcgcttga

DBGET integrated database retrieval system