KEGG   Achromobacter xylosoxidans A8: AXYL_04308Help
Entry
AXYL_04308        CDS       T01341                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXYL_04308
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_04308
   00650 Butanoate metabolism
    AXYL_04308
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04308
   00622 Xylene degradation
    AXYL_04308
   00621 Dioxin degradation
    AXYL_04308
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AXYL_04308
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     AXYL_04308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4606940..4607845)
Genome map
AA seq 301 aa AA seqDB search
MSGKLRAAIIGSGNIGTDLLAKLKRSAVLEPVWMVGIDPESDGLQRARDMGLEVTADGVD
GLLPHVEEAGIRFAFDATSAYVHKENSDKLTALGVKVIDLTPAAIGPYCVPPVNLKDLAG
RQENNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSAGPGTRKNIDEFTRTTAG
AVERIGGAKRGKAIIILNPAEPPMIMRDTVHCLTESEPDQARITESVHAMIAEVQKYVPG
YRLVNGPVFDGNRVSVYLEVEGLGDYLPKYSGNLDIMTAAAVRSAEMFAEQMLASAAQAA
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaactgcgggccgcgatcatcggctcgggcaatatcggcaccgacttgctg
gccaagctgaagcgcagtgcggtgctggaaccggtctggatggtgggcatcgatccggaa
tcagacgggttgcagcgcgcgcgggacatgggcctcgaggtcaccgccgacggcgtggac
ggcttgcttccccacgtggaggaggctggcatccgcttcgcgttcgacgccaccagcgcc
tatgtgcacaaggaaaactcggacaagctcaccgcgctgggcgtcaaggtgattgacctc
acgccggccgccatcggcccctactgcgtgccgccggtaaacctcaaggatctggcgggc
cggcaggagaacaacgtcaacatggtgacctgcggcggccaggcgaccattcccatggtg
tatgcggtgtcgcgcgtgcagccggtggcgtatggcgagatcgtggccacggtgtcctcg
cgctcggcggggccgggcacgcgcaagaacatcgatgagttcacccgcaccacggccggc
gcggtggaacgcatcggcggcgccaagcggggcaaggccatcatcatcctcaatccggcg
gaaccgccgatgatcatgcgcgatacggtccattgcctgaccgagagcgagccggaccag
gcgcgcatcaccgagtccgtgcacgccatgatcgccgaagtgcagaagtacgtgccgggc
tatcgcctggtcaacggaccagtgttcgacggcaaccgggtgtcggtctacctggaggtc
gagggcctgggcgactacctgcccaagtattcggggaatctcgacatcatgaccgcggcg
gccgtgcgcagcgccgaaatgttcgccgagcagatgctggcgtccgccgcccaggcagca
aactag

DBGET integrated database retrieval system