KEGG   Achromobacter xylosoxidans A8: AXYL_04308Help
Entry
AXYL_04308        CDS       T01341                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00362  Benzoate degradation
axy00620  Pyruvate metabolism
axy00621  Dioxin degradation
axy00622  Xylene degradation
axy00650  Butanoate metabolism
axy01100  Metabolic pathways
axy01120  Microbial metabolism in diverse environments
axy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_04308
   00650 Butanoate metabolism
    AXYL_04308
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXYL_04308
   00622 Xylene degradation
    AXYL_04308
   00621 Dioxin degradation
    AXYL_04308
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AXYL_04308
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     AXYL_04308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh TrkA_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADP17627
UniProt: E3HXA5
Position
complement(4606940..4607845)
Genome map
AA seq 301 aa AA seqDB search
MSGKLRAAIIGSGNIGTDLLAKLKRSAVLEPVWMVGIDPESDGLQRARDMGLEVTADGVD
GLLPHVEEAGIRFAFDATSAYVHKENSDKLTALGVKVIDLTPAAIGPYCVPPVNLKDLAG
RQENNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSAGPGTRKNIDEFTRTTAG
AVERIGGAKRGKAIIILNPAEPPMIMRDTVHCLTESEPDQARITESVHAMIAEVQKYVPG
YRLVNGPVFDGNRVSVYLEVEGLGDYLPKYSGNLDIMTAAAVRSAEMFAEQMLASAAQAA
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaactgcgggccgcgatcatcggctcgggcaatatcggcaccgacttgctg
gccaagctgaagcgcagtgcggtgctggaaccggtctggatggtgggcatcgatccggaa
tcagacgggttgcagcgcgcgcgggacatgggcctcgaggtcaccgccgacggcgtggac
ggcttgcttccccacgtggaggaggctggcatccgcttcgcgttcgacgccaccagcgcc
tatgtgcacaaggaaaactcggacaagctcaccgcgctgggcgtcaaggtgattgacctc
acgccggccgccatcggcccctactgcgtgccgccggtaaacctcaaggatctggcgggc
cggcaggagaacaacgtcaacatggtgacctgcggcggccaggcgaccattcccatggtg
tatgcggtgtcgcgcgtgcagccggtggcgtatggcgagatcgtggccacggtgtcctcg
cgctcggcggggccgggcacgcgcaagaacatcgatgagttcacccgcaccacggccggc
gcggtggaacgcatcggcggcgccaagcggggcaaggccatcatcatcctcaatccggcg
gaaccgccgatgatcatgcgcgatacggtccattgcctgaccgagagcgagccggaccag
gcgcgcatcaccgagtccgtgcacgccatgatcgccgaagtgcagaagtacgtgccgggc
tatcgcctggtcaacggaccagtgttcgacggcaaccgggtgtcggtctacctggaggtc
gagggcctgggcgactacctgcccaagtattcggggaatctcgacatcatgaccgcggcg
gccgtgcgcagcgccgaaatgttcgccgagcagatgctggcgtccgccgcccaggcagca
aactag

DBGET integrated database retrieval system