KEGG   Achromobacter xylosoxidans A8: AXYL_04372Help
Entry
AXYL_04372        CDS       T01341                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00630  Glyoxylate and dicarboxylate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01200  Carbon metabolism
Module
axy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AXYL_04372 (aceA)
Enzymes [BR:axy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AXYL_04372 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: ADP17691
UniProt: E3HEW4
Position
complement(4672726..4674045)
Genome map
AA seq 439 aa AA seqDB search
MSHRETEIRNLQKDWAENARWQGIKRDYSAEDVIRLRGSIGVEHTLARRGATRLWELLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNSLTRCDQIQWMEGKNPGDEGYIDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASG
VHFEDQLASVKKCGHMGGKVLVPTREAVAKLVSARLAADTMGTPTVLLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTKAGIDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAIHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAEMGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEHGKEQKVA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccgcgaaaccgaaatccgcaatctgcagaaggactgggccgaaaacgcccgc
tggcaaggcatcaagcgcgactacagcgccgaggacgtcatccgcctgcgcggctccatc
ggcgtggaacacacgctggcgcgccgcggcgccacccgcctgtgggaactgctgcatagc
gagcctttcgtgaattcgctgggcgccctgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtcgggctggcaggttgccggcgacgccaacctggcc
ggcgaaatgtatcccgaccagtcgctgtaccccgccaactcggtgccgcaggtggtccgc
cgcatcaacaactcgctgacccgctgcgaccagatccagtggatggaaggcaagaacccg
ggcgacgaaggctacatcgatttcttcgcgcccatcgtggcggatgccgaagccggcttc
ggcggcgtgctgaacgccttcgaactgatgaaggccatgatcgaagcgggcgcctcgggc
gtgcacttcgaagaccagctggcttcggtgaagaagtgcggccacatgggcggcaaggtg
ctggttccgacccgcgaggccgtggccaagctggtgtcggcgcgcctggcggccgacacg
atgggcacgcccaccgtgctgctggcccgcaccgacgccgacgcagccgacctggtgacc
agcgacgtcgacgaaaacgaccgtcccttcatcaccggcgagcgcaccgtcgaaggcttc
ttccgcaccaaggccggcatcgaccaggccatctcgcgcggcctggcctatgccccgtac
gccgacctgatctggtgcgagacgtccacgcccaacctggaatacgcccgcaagttcgcc
gaggccatccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcaccatcgccaagttccagcgcgagctgggcgcc
atgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactacggcatg
ttcgaactggcccacggctacgcccgccgccagatgagcgccttcgtcgaactgcagcag
aaggaattcgccgctgctgaaatgggcttcaccgccgtgaagcaccagcgcgaagtcggc
accggctacttcgacgccgtcacgcagaccatcgaaggcggccagtcctcgaccaccgcg
ctgacgggctcgacggaagaggcccagttcgaacacggcaaggagcagaaggtcgcgtaa

DBGET integrated database retrieval system