KEGG   Achromobacter xylosoxidans A8: AXYL_04498Help
Entry
AXYL_04498        CDS       T01341                                 

Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXYL_04498
   01212 Fatty acid metabolism
    AXYL_04498
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AXYL_04498
   00650 Butanoate metabolism
    AXYL_04498
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_04498
   01040 Biosynthesis of unsaturated fatty acids
    AXYL_04498
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXYL_04498
   00310 Lysine degradation
    AXYL_04498
   00380 Tryptophan metabolism
    AXYL_04498
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AXYL_04498
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AXYL_04498
   00281 Geraniol degradation
    AXYL_04498
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AXYL_04498
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AXYL_04498
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AXYL_04498
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AXYL_04498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4822726..4824684
Genome map
AA seq 652 aa AA seqDB search
MTTLDTLSHWRLDRDTDGLAWLTFDRAGSAVNALSADTMGELAVVLDALDAVPPAGLIIQ
SGKATGFIVGADVNEFASLDTPEQARALVARGWNLFNRLAAVRYPTLALIQGHCLGGGLE
LALACRYRLVADQPGTSLALPEVMLGIFPGWGGMLRLPQLIGAPAALDMMLTGRGADARR
AAALGLADARVPPRLLLAAARQTVLSRKAPRRARGFGGWANRWPLKAIVASRARKQIAAK
DPLGHYPAAPAIVDIWEKHGGNALQAPALIDRIISSDTARNLLRVFRLQDRLKANGKQAG
IAPARHVHVVGAGVMGGDIAAWCALKGMTVTLQDQDMARIAPAIKRAAQLYSRRLKDPRL
ARAAFDRLMPDPAGGGVPLADIVIEAISEQPEAKRALYRSLEPRMKADALLATNTSSLAL
ETLRAGLAHPERLVGIHFFNPAAKMPLVEVVHAEGDAGDAQARACAFVGQIDKLALPVKS
APGFLVNAVLAPYMLEAMRSVDEGLAPEAVDAAMVAFGMPMGPLELADTVGLDIARAAGE
ELAGGAEPPRCLAERLARGDLGKKSGRGFYIWRDGKPAKGASPAGAPAGLAQRLIQPLID
ATRQRVDAGIVADADLADAGVIFGTGFAPFTGGPLHYQSSKALRDIRPAEAD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactggatacgctatcccactggcgcctggaccgcgataccgacggcctggcg
tggctgaccttcgaccgcgccggcagcgcggtcaatgccttgtccgccgacaccatgggc
gagctggcggtggtgctggatgcgctggacgcagtcccgcccgcggggttgatcatccag
tccggcaaggccacgggcttcatcgtgggcgccgacgtcaatgaattcgccagcctggac
acgccggaacaggcgcgcgcgctggtcgcgcgcggctggaatctcttcaaccgcctggcc
gcggtgcgctatccgacgctggcgctgatccagggccactgcctgggcggcggcctggag
ctggcgctggcctgccgctaccggctggtggcggaccagcccggcacctcgctcgcgctg
cccgaagtgatgctggggattttccccggctggggcggcatgctgcgcctgccgcaactg
ataggcgcgcccgccgcgctcgacatgatgctgaccggccgcggcgccgacgcgcgccgc
gccgccgcattgggtcttgccgacgcgcgcgtgccgccgcgcctgctgctggccgccgcg
cgccagacggtgctgtcgcgcaaggcgccgcgccgcgcgcgcggcttcggcggctgggcc
aaccgctggccgctcaaggccatcgtcgccagccgcgcccgcaagcagatcgccgccaag
gatccgctgggccactatcccgccgcgcccgccatcgtcgatatctgggaaaaacacggc
ggcaacgccctgcaggcgcccgcgctgatcgaccgcatcatttcctccgacaccgcccgc
aacctgctgcgggtgttccgcctgcaggaccggctgaaggccaacggcaaacaggccggc
atcgcgcccgcgcgccatgtgcacgtggtgggcgccggggtgatgggcggcgatatcgcc
gcctggtgcgcgctcaagggcatgacggtcaccttgcaggaccaggacatggcgcgcatc
gcgccggccatcaagcgcgccgcccagctgtactcgcgccgcctgaaggatccgcggctg
gcgcgcgcggcgttcgaccgcctgatgcccgacccggcgggcggcggcgtgccgctggcc
gacatcgtcatcgaagccatcagcgaacagcccgaggccaaacgcgcgctctaccgttcg
ctggaaccgcgcatgaaggccgatgccctgctcgccaccaacacctccagcctggcactg
gagaccttgcgcgcaggccttgcgcacccagaacgtctggtgggcatccacttcttcaat
cccgcggccaagatgcccctggtggaggtggtgcacgccgaaggcgacgcaggcgacgcg
caagcccgcgcctgcgccttcgtcgggcagatcgacaagctggcgctgccggtcaagagc
gcgccgggcttcctggtcaacgccgtgctggcgccctatatgctggaggccatgcgcagc
gtggatgaaggcttggcgcccgaggccgtggacgcggccatggtcgccttcggcatgccg
atgggaccgctggagctggcagataccgtgggcttggacatcgcgcgcgcggcaggcgag
gaacttgctggcggcgccgagccgccgcgctgcctggccgagcgcctggcgcgcggcgac
ctgggcaagaagagcggccgcggcttctacatctggcgcgacggcaagccggccaagggc
gccagccccgccggcgcgcccgccggactggcgcagcgcctgatccagccgctgatagac
gccacgcgccagcgcgtggacgcgggcatcgtcgccgacgccgacctggcggacgcgggc
gtgattttcggaacggggttcgcgccattcacgggcggccccttgcattaccagagcagt
aaagcattgcgcgatataagaccggctgaggccgattag

DBGET integrated database retrieval system