KEGG   Achromobacter xylosoxidans A8: AXYL_04548Help
Entry
AXYL_04548        CDS       T01341                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:axy00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4874843..4876759
Genome map
AA seq 638 aa AA seqDB search
MSDKNPDKAGLTRRSFLGTAAITGAAGLVAGAQISTAHGKDAKGGANGVLGHVAPGELDE
YYAFNSSGQSGEVRVLGLPSMRELVRIPVFNHCSATGWGRTNESRKILTEGLTPETREYL
KDKGGVFINGDAHHPHLSFTDRTYDGRYLYINDKANNRVARIRLDVMKTDKITELPNVSG
VHGLRPQRYPRTGYVFANGEHIIPLPNDGKVTDDPKKNFFAIYTALDGDTMKVAWQVLVD
GNLDNGDADYQGKYSFSTCYNSEKGVTVEEASANEQDWVVVFNIKRIEEAVKKGDFKTMG
GVPVIDGRHGSKYTRYIPVPNSPHGCNAAPDGIHLVLNGKLSPTVTVLDVRTLDDLFDDK
IKPRDCVVAEPQLGLGPLHTAFDGRGNAYTTLFIDSQMVKWNIDKAKRAFKGEKVDPIIQ
KLDVHYQPGHNHSTMGETREADGKWLVSLNKFSKDRFLNVGPLKPENDQLIDISGDEMKL
VHDGPSFAEPHDMCLVHRSKVHPISVWKRDDPMWEDARQMAKKDGVSLDDAAKVVRDGNK
VRVYMMAVAPMFSIKKFEVNQGDEVTVVVTNMEVIEDLTHGFTLEGHGIAMEIGPQATAS
VTFTADRLGVYWYYCQWFCHALHMEMSGQMVVHPKKTV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaagaaccccgacaaggccggcctcacccgccgcagcttcctcggaaccgca
gccatcacgggcgccgcaggcctggtggcgggcgcgcagatctccaccgcccacggcaag
gacgccaagggcggcgccaatggcgtgctgggccatgtcgccccgggcgagctcgacgaa
tactacgctttcaattccagcggccaatcgggcgaggtccgcgtgctgggcctgccgtcc
atgcgcgagctggtccgcattccggtcttcaaccattgcagcgccaccggctggggccgc
accaacgaaagccgcaagatcctgaccgaaggcctcacccccgagacccgcgaatacctg
aaggacaagggcggcgtgttcatcaacggcgacgcccaccacccgcacctctcgttcacc
gaccgcacctacgacggccgctacctgtacatcaacgacaaggccaacaaccgcgtcgcc
cgcatccgcctggatgtgatgaagacggacaagatcaccgaactgcccaacgtgtccggc
gtgcacggcctgcggccgcagcgctacccgcgcaccggctatgtgttcgccaacggcgag
cacatcatccccctgcccaacgacggcaaggtgacggacgatcccaagaagaacttcttc
gccatctacaccgcgctggacggcgacaccatgaaggtcgcctggcaggtgctggtcgac
ggcaacctggacaacggcgacgccgactaccagggcaagtactcgttctccacctgctac
aactcggagaaaggcgtcacggtggaagaagcctcggccaacgagcaggactgggtcgtg
gtgttcaacatcaagcgcatcgaagaagccgtcaagaagggcgacttcaagaccatgggc
ggcgtgccggtgatcgatgggcgccacggttccaagtacacccgctacattccggtgccg
aactcgccgcacggctgcaacgccgcgcccgacggcatccacctggtgctcaacggcaag
ctctcgcccaccgtcacggtgctggacgtgcgcacgctggacgacctgttcgacgacaag
atcaagccgcgcgattgcgtggtggccgaaccccagctgggcctgggcccgctgcacacg
gcattcgacggccgcggcaacgcctacaccacgctgttcatcgacagccagatggtcaag
tggaacatagacaaggccaagcgcgcgttcaagggcgagaaggtcgatccgatcatccag
aagctggacgtgcactaccagcccggccacaaccattcgaccatgggcgaaacccgcgag
gccgacggcaagtggctggtgtcgctgaacaagttctccaaggaccgcttcctgaacgtc
ggcccgctcaagcccgagaacgaccagctcatcgacatttcgggcgacgaaatgaagctg
gtgcatgacggccccagcttcgccgagccgcatgacatgtgcctggtgcaccgctccaag
gtccatcccatcagcgtctggaagcgcgacgaccccatgtgggaagacgcccgccagatg
gccaagaaggacggcgtgtcgctggacgatgcagccaaggtggtgcgcgacggcaacaag
gtgcgcgtgtacatgatggcggtcgcgcccatgttcagcatcaagaagttcgaggtcaac
cagggcgacgaggtcaccgtggtggtcacgaacatggaggtgatcgaagacttgacgcac
ggcttcacgctggaaggccacggcatcgccatggagatcggaccccaggctaccgcctcg
gtcaccttcacggcagaccgtctgggcgtgtactggtactactgccagtggttctgccac
gcgctgcacatggaaatgtccggccagatggtcgtgcatcccaagaagaccgtgtag

DBGET integrated database retrieval system