KEGG   Achromobacter xylosoxidans A8: AXYL_04978Help
Entry
AXYL_04978        CDS       T01341                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AXYL_04978 (folP)
Enzymes [BR:axy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AXYL_04978 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5342609..5343397)
Genome map
AA seq 262 aa AA seqDB search
MGIVNVTPDSFSDGGQHDDTDSAVAHARQLIAEGAQILDLGGESTRPGADPVSVADELAR
LLPVMEALRDCGVPLSIDTFKPEVMRAVLDAGADMINDIYGFRQPGAVEAVAHSRCGLCV
MHMKGEPRTMQAAPPEYSDLIGEIGLFLGARAHKLRAAWIDPRRIVLDPGFGFGKTGDQN
FQLLRRLSSLRSAGYPLLIGLSRKSMIGQATGRPVGDRLPGSIAAALACVARGASIVRVH
DVAATVDALKVWHAAEQGAISS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgtcaacgtcacgccggattcgttttccgacggaggccagcacgacgatacc
gattccgcagtggcgcatgcgcgccaattgatcgccgaaggcgcccagatcctggatctg
ggcggcgagtccacgcgccccggggcggatccggtctcggtggccgacgaactggcccgg
ctgctgccggtgatggaggcgctgcgcgattgcggcgtgcccctgtccatcgacaccttc
aagccggaagtcatgcgcgccgtgctggacgccggcgctgacatgatcaacgacatttat
ggcttcaggcagcccggcgccgtcgaggcggtggcgcattcgcgctgcgggctatgcgtg
atgcacatgaagggcgagccccgcaccatgcaggccgccccacccgaatactccgacctg
atcggtgaaatcgggctcttcctgggggcccgcgcgcacaagctgcgcgcggcctggatc
gatcctcgccgcatcgtgctggacccgggcttcggcttcggcaagacgggcgaccagaat
ttccaactgctgcgccggctgtccagcttgcgcagcgccggctatccattgctgatcggc
ctgtcgcgcaaatccatgatcggccaggctaccggccggcccgtgggcgacaggttgccc
ggcagcatcgccgcggcgcttgcctgcgtggcgcgtggcgcttccatcgtgcgtgtgcac
gatgtggcggccacggttgacgcgctcaaggtatggcacgcggcagaacaaggagcaatc
agttcatga

DBGET integrated database retrieval system