KEGG   Achromobacter xylosoxidans A8: AXYL_05019Help
Entry
AXYL_05019        CDS       T01341                                 

Gene name
adh2
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXYL_05019 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_05019 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_05019 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXYL_05019 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXYL_05019 (adh2)
   00626 Naphthalene degradation
    AXYL_05019 (adh2)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXYL_05019 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5391566..5392591
Genome map
AA seq 341 aa AA seqDB search
MDKTMKAAVARAFGKPLAIEEVAVPRPGPGELLVKIEACGVCHTDLHAVEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEQQQNAGYSV
NGGFAEYALAAADYVGLLPKNVSFVDIAPVLCAGVTVYKGLKMTDTRPGNWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDAKLDFARRLGAEVTVNAKTTDPAAYLKREIGGAHGALI
TAVSPKAFEQALGMVRRGGTVALNGLPPGDFPLSIFDMVLNGVTVRGSIVGSRLDLQESL
QFAEEGKVHATVATESLENINDVFDRMRRGQIEGRIVLDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaccatgaaagcagcggttgcacgagcattcggcaagcccctggcaatcgaa
gaagtcgcggtgccgcgcccgggtccgggcgaattgctggtgaagatcgaggcctgcggg
gtatgccataccgacctgcacgcggtcgaaggcgactggcccgtcaagcccaatccgccc
ttcattcccggccacgaaggcgtcggccatgtggtggcggtgggcgccggcgtgacccat
gtgaaggaaggcgaccgcgtcggcattccctggctgtactctgcctgcgggcattgcgag
cattgcctgggcggctgggaaaccctgtgcgaacaacagcagaacgccggctactcggtg
aacggcggcttcgccgaatatgcgctggccgcggccgactatgtgggcctgctgcccaag
aacgtcagtttcgtggacatcgcgcccgtgctgtgcgccggcgtcacggtctacaagggc
ctgaagatgacggatacccgtccgggcaactgggtggtcatttccggcatcggcgggctg
ggccacatggcggtgcaatacgccaaggccatggggctgaacgtggctgcggtggacatc
gacgacgccaagctcgacttcgcccgccgcctgggcgccgaagtcacggtcaacgccaag
accaccgatcccgccgcctacctgaagcgcgagatcggcggcgcgcatggcgcattgatc
acggcggtgtcgcccaaggccttcgaacaggcgttgggcatggtgcgccgcggcggcacc
gtggcgctcaacggactgccgccgggcgacttcccgctgtcgatcttcgatatggtgctc
aatggcgtcaccgtgcgcggctccatcgtgggttcgcgcctggacctgcaggaatcgctg
cagttcgccgaagagggcaaggtgcatgcgaccgtggccactgaaagcctggagaacatc
aacgacgtgttcgaccgcatgcgccgcggccagatcgaaggccgcatcgtgctcgatttc
gcctga

DBGET integrated database retrieval system