KEGG   Achromobacter xylosoxidans A8: AXYL_05019Help
Entry
AXYL_05019        CDS       T01341                                 

Gene name
adh2
Definition
(GenBank) alcohol dehydrogenase 2
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00071  Fatty acid degradation
axy00350  Tyrosine metabolism
axy00625  Chloroalkane and chloroalkene degradation
axy00626  Naphthalene degradation
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_05019 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    AXYL_05019 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXYL_05019 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXYL_05019 (adh2)
   00626 Naphthalene degradation
    AXYL_05019 (adh2)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXYL_05019 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ADP18325
UniProt: E3HNY6
Position
5391566..5392591
Genome map
AA seq 341 aa AA seqDB search
MDKTMKAAVARAFGKPLAIEEVAVPRPGPGELLVKIEACGVCHTDLHAVEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEQQQNAGYSV
NGGFAEYALAAADYVGLLPKNVSFVDIAPVLCAGVTVYKGLKMTDTRPGNWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDAKLDFARRLGAEVTVNAKTTDPAAYLKREIGGAHGALI
TAVSPKAFEQALGMVRRGGTVALNGLPPGDFPLSIFDMVLNGVTVRGSIVGSRLDLQESL
QFAEEGKVHATVATESLENINDVFDRMRRGQIEGRIVLDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaccatgaaagcagcggttgcacgagcattcggcaagcccctggcaatcgaa
gaagtcgcggtgccgcgcccgggtccgggcgaattgctggtgaagatcgaggcctgcggg
gtatgccataccgacctgcacgcggtcgaaggcgactggcccgtcaagcccaatccgccc
ttcattcccggccacgaaggcgtcggccatgtggtggcggtgggcgccggcgtgacccat
gtgaaggaaggcgaccgcgtcggcattccctggctgtactctgcctgcgggcattgcgag
cattgcctgggcggctgggaaaccctgtgcgaacaacagcagaacgccggctactcggtg
aacggcggcttcgccgaatatgcgctggccgcggccgactatgtgggcctgctgcccaag
aacgtcagtttcgtggacatcgcgcccgtgctgtgcgccggcgtcacggtctacaagggc
ctgaagatgacggatacccgtccgggcaactgggtggtcatttccggcatcggcgggctg
ggccacatggcggtgcaatacgccaaggccatggggctgaacgtggctgcggtggacatc
gacgacgccaagctcgacttcgcccgccgcctgggcgccgaagtcacggtcaacgccaag
accaccgatcccgccgcctacctgaagcgcgagatcggcggcgcgcatggcgcattgatc
acggcggtgtcgcccaaggccttcgaacaggcgttgggcatggtgcgccgcggcggcacc
gtggcgctcaacggactgccgccgggcgacttcccgctgtcgatcttcgatatggtgctc
aatggcgtcaccgtgcgcggctccatcgtgggttcgcgcctggacctgcaggaatcgctg
cagttcgccgaagagggcaaggtgcatgcgaccgtggccactgaaagcctggagaacatc
aacgacgtgttcgaccgcatgcgccgcggccagatcgaaggccgcatcgtgctcgatttc
gcctga

DBGET integrated database retrieval system