KEGG   Achromobacter xylosoxidans A8: AXYL_05052Help
Entry
AXYL_05052        CDS       T01341                                 

Definition
arginase family protein 1
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AXYL_05052
Enzymes [BR:axy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AXYL_05052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5425931..5426884)
Genome map
AA seq 317 aa AA seqDB search
MQQPAEVCFHPVAGFMGLPSVRAAGSGAARACVVGIPFDCGTHPFRVGSRQGPDAIREQS
RLLRPIDIFRRHGIDNPPEFLRAIDVGNVACHPGDPDASYPLIEAGIGAILDSGAIPISM
GGDGAVTLPQLRAVARRHPDFVVLHFDSHTDTYPIPGYNTATTFTRAAEEGLLDVASSFH
VGTRGSSFMPGVLEFGREVGYTILPYDDFDQDQKGALEQIKQRIGQRPVYLCFDMDIFDP
SCAPGVCTPEWGGLTAKEGLALLRQLAGLNFVAFDVNTVSPPQDVQGATAFLAATVMQEF
CALAAVAVQQYPQGRPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagccagccgaagtctgttttcatcccgtcgccgggttcatgggcctgccttcc
gttcgcgccgccggctcgggcgcggcgcgggcctgcgtggtgggcattccctttgattgc
ggcacgcatccgttccgggtcggctcgcgccaggggccggacgcgatccgcgagcaatcc
aggctgttgcggcccatcgacatcttccggcgccacggcatcgataacccgccggagttc
ctgcgcgccatcgatgtgggcaacgtggcctgccatccgggcgatccggacgcatcctat
ccgctgatcgaggccggcatcggcgccatcctggattcgggcgccattcccatttccatg
gggggcgacggcgcggtcaccttgccgcagctgcgcgccgtggcgcgccgccatccggat
ttcgtggtgctgcatttcgattcgcacaccgacacctaccccattcctggctacaacacg
gccaccacgttcacgcgcgccgccgaagaggggctgctggacgtggcgtccagcttccac
gtcggcacgcgcggcagttccttcatgccgggcgtattggagttcgggcgcgaggtcggg
tacacgatcctgccttacgacgatttcgatcaggaccagaagggcgcgctggaacagatc
aagcagcgcatcggccagcgtccggtgtacctgtgcttcgacatggacatcttcgatccc
tcctgcgcgccgggcgtgtgcacgccggagtggggcggactgacggccaaggaagggttg
gcgttgctgcgccagctcgcgggcctgaacttcgtggcgttcgacgtcaacaccgtgtcg
ccgccgcaagacgtgcagggagccacggccttcctggccgccaccgtcatgcaggaattc
tgcgcgctggcggcggtagcggtgcagcagtatccgcaagggcgtccggcctga

DBGET integrated database retrieval system