KEGG   Achromobacter xylosoxidans A8: AXYL_05280Help
Entry
AXYL_05280        CDS       T01341                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AXYL_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5654955..5656496
Genome map
AA seq 513 aa AA seqDB search
MSASPDNSGTAALLIHGLGGTQYDLGSMHKVLRRVGIDTHSLTLPGHGTTPEDLVSVRAE
AWLDAVTAKYHEIADRYDTLHVMGMCLGALLAVELCKRVGHKKGKLVSLAAPVFIDGWST
PWYRGLRKLVYRIPGLGARMRVEEEEPYGIKNELVRSIVKAKFERGENFHYRWVPLACVR
EVDRLRGFVRRGLDRIGCPTLIVHAHEDELTSVRSAHLLHQQIAGSRLVLLDNSYHMICV
DNDRDRVAANVLEFMDQDPAAAQPARAAGRAAPMGAEDVERLLEAYRGSLLAGKFELLFP
LFAEDVVWNEAGDSPISGVYEGRGALIDLFSRLMDYSRNTFAIQGVGPPAPAGRSIALPL
SYQVQDGAQLHMGGATHTLRLRNNAISKVNAQADDPTRDDAMWRRLAAASGREPEGDAID
ADTQALTAEALPDAFEAALIERRALAREPSAAIAIRLYACEQQARHGDAPASPEPGATPL
DQVRHAAWQRLSGLPADQAQRRYIALVRRLDAA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctagcccagacaattccggcaccgctgcgctgctgatccatggcctgggcgga
acccagtacgacctgggatccatgcacaaggtgctcaggcgcgtcggcatcgacacgcac
agcctgaccctgcccgggcacggcaccacgccggaagacctggtgtcggtgcgcgcggag
gcctggttggacgccgtgaccgccaaataccatgagatcgccgaccgctacgacaccctg
cacgtgatgggcatgtgcctgggcgcgctgctggcggtcgaactctgcaagcgggtgggc
cacaagaagggcaagctggtatcgctggccgcgccggtattcatcgacggctggagcacg
ccctggtatcgcggcctgcgcaagctggtctaccgcattccgggcctgggcgcgcgcatg
cgggtcgaagaggaagagccctacggcatcaagaacgaactggtccgctccatcgtcaag
gccaagttcgaacgcggcgagaacttccactaccgctgggtgccgctggcctgcgtgcgc
gaagtcgaccggctgcgcggcttcgtcaggcgcgggctggaccgcatcggctgccccacc
ctgatcgtgcacgcccacgaagacgagctcacctccgtgcgctcggcccatctgctgcac
cagcagatcgccggcagccggctggtgctgctggacaacagctatcacatgatctgcgtg
gacaacgaccgcgaccgggtcgcagccaatgtgctcgaattcatggatcaggatcccgcc
gcggcgcaacccgcgcgcgccgccggacgcgccgcccccatgggcgcggaggacgtcgaa
cgtctgctcgaggcctaccgcggttcgctgctggctgggaaattcgaattgctgtttccc
ttgttcgccgaggacgtggtctggaacgaggcaggcgacagccccatcagcggcgtctat
gaaggccgcggcgcgctgatcgacctgttctcgcgcctgatggactactcgcgcaacact
ttcgccatccagggcgtgggcccgcccgcccccgccggccgctccatcgcgctgccgctg
agctaccaggtgcaggacggcgcgcagttgcatatgggcggcgccacgcacacgctgcgc
ctgcgcaacaacgccatctccaaggtcaacgcccaggccgacgaccccacgcgcgacgat
gccatgtggcgccggctggccgccgccagcggccgggagcccgagggcgacgccatcgac
gcggacacccaggccctgacggccgaagcgctgcccgacgcctttgaagccgcgctcatc
gagcggcgggccctggcccgcgaaccttcggccgccatcgccatccggctgtacgcctgc
gagcagcaggcgcgccacggcgatgcgccggcctcgcccgaacccggcgcgacgccgctg
gaccaggtgcggcacgccgcctggcaacggctatccggcttgccggccgatcaggcgcag
cgccgctacatcgcgctggtgcggcgcttggacgcagcctga

DBGET integrated database retrieval system