KEGG   Achromobacter xylosoxidans A8: AXYL_05438Help
Entry
AXYL_05438        CDS       T01341                                 

Gene name
trpA2
Definition
(GenBank) tryptophan synthase, alpha subunit 2 (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_05438 (trpA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_05438 (trpA2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXYL_05438 (trpA2)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXYL_05438 (trpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5812971..5813756)
Genome map
AA seq 261 aa AA seqDB search
MTRLDQTLSALRQSGRSGLVTYFAAGDPDPAACLELLRGLCAAGADVIELGMPFSDPVAD
GPVLQQANVRALAGGQTLKRTLALVREFRDTDAHTPMVLMGYLNPILRHGVESFIRDAAT
AGVDGLIIIDLPVEHADDIGREAREHGLHLIRMSAPTSEDARLAGLLRDASGFVYHIMLA
GTTGADLPDERRIAQDLERLRSHTRLPVAAGFGVRSPDEARLVARHADLVVVGSRLAQVL
AEQGVAGALDEVRTLAAALRQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacacggctggatcaaaccctttccgcgctgcgccaatccggacgcagcggcctggtt
acctacttcgcggcgggcgaccccgatcccgccgcgtgcctggaactgctgcgcggcttg
tgcgcggcgggcgcggacgtgatcgaactcggcatgccgttcagcgatccggtcgcggac
ggccccgtgctgcagcaggcgaacgtccgcgcgctggccggcggccagaccttgaagcgc
acgctggctctggtgcgcgagttccgcgatacggacgcgcatacgcccatggtgctgatg
ggttatctgaatcccatcctgcggcatggcgttgaaagcttcatccgggacgcggccacc
gcgggcgtggacggcctgatcatcatcgacctgccggtcgagcatgccgacgatatcggg
cgggaagcgcgcgagcatggcctgcacctgatccgcatgtccgcgccgacgtccgaggac
gcgcggctggcgggattgctacgcgacgccagcggcttcgtctatcacatcatgctggcc
ggcacgacgggcgcggacctgcccgacgagcgccgcatcgcgcaggatctggagcgcttg
cgctcgcatacgaggctgccggtggccgcgggctttggcgtgcgctcgccggacgaggcc
cggctcgtggctcggcatgccgatctggtggtggtcggttcacggcttgcgcaggtgttg
gcggagcagggcgtggcgggcgcgctggatgaggtgcggacgttggcggcggcgctgcgg
cagtga

DBGET integrated database retrieval system