KEGG   Achromobacter xylosoxidans A8: AXYL_05607Help
Entry
AXYL_05607        CDS       T01341                                 

Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:axy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:axy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:axy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:axy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:axy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:axy00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:axy00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:axy00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6004038..6005429
Genome map
AA seq 463 aa AA seqDB search
MGNNTQFPGSVFKAYDIRGTVPDLIDARFARALGAALAARAREQGVQTLVVGRDGRLSSE
MLSVALQEGMLEGGVDTLDIGMVPTPLVYFAANVMQTGSGVAITGSHNPPKYNGFKMMMG
GRALYGEDVQALAASMNGAASAPAARPGVRRQLDLVAAYIARVASGVQLARPMKIAIDCG
NGVAGAVAPALFRALGCEVTELFCEVDGTFPNHHPDPAEPKNLQDLIKCVAETDCELGLA
FDGDGDRLGVVTKSGQIVWPDRQLVLFARDVLDRNPGATIIYDVKCSRHVGLSVEAAGGV
PLMWKTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRDADPC
AVLEALPQDVSTPELKLEMEEGQPFTLVQALQDQGQFPGADRVITIDGVRAEYPDGFGLA
RPSNTTPVVVLRFEAQTPAALQRIQADFRRELSKLAPQADLPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaacaacacgcaatttccgggatcggtcttcaaggcctatgacatccgcggcacc
gtgcccgacctgatcgacgcccgcttcgcccgcgccctgggcgcggcgctggccgcccgc
gcgcgcgagcaaggcgtgcagaccctggtcgtcggccgcgatggccgcctgagcagcgaa
atgctatcggtggcgctgcaggaaggcatgctggaaggcggcgtggacaccctggacatc
ggcatggtgcccacccccctggtctacttcgccgccaacgtcatgcaaaccggctcgggt
gtcgccatcaccggcagccacaacccgcccaagtacaacggcttcaagatgatgatgggc
ggccgcgcgctctacggcgaggacgtgcaggccctggccgccagcatgaacggcgccgcc
agcgccccggcggcgcggcccggcgtgcgccgccagctggacctggtggccgcttacatc
gcgcgcgtggcatcgggcgtccagctggcgcgacccatgaagatcgccatcgattgcggc
aacggcgtggccggcgcagtcgccccggcgctgttccgcgccctgggctgcgaagtcacc
gaactgttctgcgaagtggacggcaccttccccaaccatcatcccgatcctgccgagccc
aagaatctgcaggacctgatcaagtgcgtggccgagaccgactgcgagctgggcctggca
ttcgacggcgacggcgaccgcctgggcgtggtgaccaaatcgggccagatcgtctggccg
gaccgtcaactggtgctgttcgcccgcgatgtgctggaccgcaacccgggagcgaccatc
atctatgacgtgaagtgcagccggcatgtcggcctgtcggtcgaggccgccggcggcgtg
ccgctgatgtggaagaccggccattcgctggtgaaggccaagctggccgagaccggcgct
ccgctggccggcgagatgagcggccacatcttcttcaaggagcgctggtacggcttcgac
gacggcctctacacgggcgcccgcctgctggagatcgtgtcacgcgacgccgacccctgc
gcggtgctggaagctctcccgcaagacgtttccacgcccgaactgaagctggaaatggaa
gaaggccagcctttcaccctggtccaggccctgcaggaccaggggcagttccccggcgcg
gaccgcgtgatcacgatcgacggcgtgcgcgcggagtatccggacggcttcggcctggcg
cgcccctcgaataccactccggtagtcgtgctgcgcttcgaagcccagacgcccgcggcg
ctgcaacgcatacaagccgacttccgccgcgagctgagcaagctcgcgccccaagccgat
ctgcctttctag

DBGET integrated database retrieval system