KEGG   Achromobacter xylosoxidans A8: AXYL_05607Help
Entry
AXYL_05607        CDS       T01341                                 

Definition
(GenBank) phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00030  Pentose phosphate pathway
axy00051  Fructose and mannose metabolism
axy00052  Galactose metabolism
axy00230  Purine metabolism
axy00500  Starch and sucrose metabolism
axy00520  Amino sugar and nucleotide sugar metabolism
axy00521  Streptomycin biosynthesis
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_05607
   00030 Pentose phosphate pathway
    AXYL_05607
   00051 Fructose and mannose metabolism
    AXYL_05607
   00052 Galactose metabolism
    AXYL_05607
   00500 Starch and sucrose metabolism
    AXYL_05607
   00520 Amino sugar and nucleotide sugar metabolism
    AXYL_05607
  Nucleotide metabolism
   00230 Purine metabolism
    AXYL_05607
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AXYL_05607
Enzymes [BR:axy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     AXYL_05607
    5.4.2.8  phosphomannomutase
     AXYL_05607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADP18906
UniProt: E3HF47
Position
6004038..6005429
Genome map
AA seq 463 aa AA seqDB search
MGNNTQFPGSVFKAYDIRGTVPDLIDARFARALGAALAARAREQGVQTLVVGRDGRLSSE
MLSVALQEGMLEGGVDTLDIGMVPTPLVYFAANVMQTGSGVAITGSHNPPKYNGFKMMMG
GRALYGEDVQALAASMNGAASAPAARPGVRRQLDLVAAYIARVASGVQLARPMKIAIDCG
NGVAGAVAPALFRALGCEVTELFCEVDGTFPNHHPDPAEPKNLQDLIKCVAETDCELGLA
FDGDGDRLGVVTKSGQIVWPDRQLVLFARDVLDRNPGATIIYDVKCSRHVGLSVEAAGGV
PLMWKTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRDADPC
AVLEALPQDVSTPELKLEMEEGQPFTLVQALQDQGQFPGADRVITIDGVRAEYPDGFGLA
RPSNTTPVVVLRFEAQTPAALQRIQADFRRELSKLAPQADLPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaacaacacgcaatttccgggatcggtcttcaaggcctatgacatccgcggcacc
gtgcccgacctgatcgacgcccgcttcgcccgcgccctgggcgcggcgctggccgcccgc
gcgcgcgagcaaggcgtgcagaccctggtcgtcggccgcgatggccgcctgagcagcgaa
atgctatcggtggcgctgcaggaaggcatgctggaaggcggcgtggacaccctggacatc
ggcatggtgcccacccccctggtctacttcgccgccaacgtcatgcaaaccggctcgggt
gtcgccatcaccggcagccacaacccgcccaagtacaacggcttcaagatgatgatgggc
ggccgcgcgctctacggcgaggacgtgcaggccctggccgccagcatgaacggcgccgcc
agcgccccggcggcgcggcccggcgtgcgccgccagctggacctggtggccgcttacatc
gcgcgcgtggcatcgggcgtccagctggcgcgacccatgaagatcgccatcgattgcggc
aacggcgtggccggcgcagtcgccccggcgctgttccgcgccctgggctgcgaagtcacc
gaactgttctgcgaagtggacggcaccttccccaaccatcatcccgatcctgccgagccc
aagaatctgcaggacctgatcaagtgcgtggccgagaccgactgcgagctgggcctggca
ttcgacggcgacggcgaccgcctgggcgtggtgaccaaatcgggccagatcgtctggccg
gaccgtcaactggtgctgttcgcccgcgatgtgctggaccgcaacccgggagcgaccatc
atctatgacgtgaagtgcagccggcatgtcggcctgtcggtcgaggccgccggcggcgtg
ccgctgatgtggaagaccggccattcgctggtgaaggccaagctggccgagaccggcgct
ccgctggccggcgagatgagcggccacatcttcttcaaggagcgctggtacggcttcgac
gacggcctctacacgggcgcccgcctgctggagatcgtgtcacgcgacgccgacccctgc
gcggtgctggaagctctcccgcaagacgtttccacgcccgaactgaagctggaaatggaa
gaaggccagcctttcaccctggtccaggccctgcaggaccaggggcagttccccggcgcg
gaccgcgtgatcacgatcgacggcgtgcgcgcggagtatccggacggcttcggcctggcg
cgcccctcgaataccactccggtagtcgtgctgcgcttcgaagcccagacgcccgcggcg
ctgcaacgcatacaagccgacttccgccgcgagctgagcaagctcgcgccccaagccgat
ctgcctttctag

DBGET integrated database retrieval system