KEGG   Achromobacter xylosoxidans A8: AXYL_05934Help
Entry
AXYL_05934        CDS       T01341                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00020  Citrate cycle (TCA cycle)
axy00620  Pyruvate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_05934
   00020 Citrate cycle (TCA cycle)
    AXYL_05934
   00620 Pyruvate metabolism
    AXYL_05934
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXYL_05934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H TraD SspB
Motif
Other DBs
NCBI-ProteinID: ADP19230
UniProt: E3HJJ8
Position
6388795..6390099
Genome map
AA seq 434 aa AA seqDB search
MAHLIKLPSVAADTSGGTLHQWLKKEGDTVAVGEALAEIETEKAIVEINAEQAGVLGRIV
VQAGAASVPVNTVIGVLLVQGEDATAIDRALAEAGAAQPTAAPAAAVAGSAGPAPVAAPA
LASASNAATSASASAAAAPQAPAAAGTAAVPGGRLFASPLARRLAAQWHVDLLGVTGTGP
HGRIVRRDVEAARDRAPAAATAPLAGRPAARRVPHTGMRRAIARRLTESKQNVPHFYLTV
DCRMDALLALRAQANQGGTVKLSVNDFIVRAAALALREVPEVNASWHEDAVEYHAGADIS
VAVATDGGLVTPIVRDADLKSLSAIAGEIVELAGRAKINRLKPEEFTGGSLTVSNLGMYG
ISQFAAIINPPQAAILAVGTAEKRPVVDSEGQLAVATVMTVTLSADHRVVDGAVGARWLA
AFRTLIENPVRILL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaccttatcaagctcccctccgttgcggccgacacctcgggcggcacgctgcac
cagtggctcaagaaagaaggcgacaccgtcgccgtgggcgaggcgctggcggaaatcgaa
accgagaaggccatcgtcgaaatcaatgccgagcaggccggcgtgctgggccgcatcgtg
gtccaggctggcgcggcctcggtgccggtcaacaccgtgatcggcgtgctgctggtccag
ggcgaagacgctacggctatcgaccgcgcgctggccgaagccggcgccgcgcagcccacg
gcagcacctgcggctgcggttgctggcagcgctggcccggcccctgtcgccgccccggct
ttggcatcggccagcaacgctgccacctcggcttctgcgagcgccgcagccgcgcctcag
gcacccgctgccgcaggcaccgcagctgttcctggcggacgcttgttcgccagcccgctg
gcacggcgcctggccgcgcaatggcatgtggacctgctgggtgtgaccggcaccggcccg
cacggtcgcatcgtgcgccgcgacgtggaagcggcacgagaccgggctccggccgccgca
accgcgccgctggccggccgtccagccgcacgccgcgtcccgcacactggcatgcgccgc
gccatcgcccgccgcctcacggaaagcaagcagaacgtgccgcacttctacctgacggtg
gattgcaggatggacgcgctgctggccctgcgcgcgcaagccaatcaaggcggcacggta
aaactgtcggtcaatgacttcatcgtgcgcgcggcggcgctggccctgcgcgaagtgccg
gaggtgaacgccagctggcatgaagatgccgtcgagtaccacgccggcgccgacatctcg
gtggcggtggcgaccgatggcggcctggtcacgcccatcgtgcgcgacgcggacctgaag
tccttgtccgccatcgcgggtgaaatcgtcgagctggccggccgcgccaagatcaaccgt
ctgaaacccgaggaattcaccggcggctcgctgaccgtgagcaacctgggcatgtacggc
atcagccagttcgctgccatcatcaatccgccgcaggccgccatcctggcggtgggcacg
gccgagaagcgcccggtggtggacagcgaaggccaactggccgtcgccaccgtcatgacg
gtgaccttgtcggcagaccaccgcgtggtggacggcgcggtgggcgcgcgctggctggcc
gccttccgcacgctgatcgaaaaccccgtgcgcatcctgttgtga

DBGET integrated database retrieval system