KEGG   Achromobacter xylosoxidans A8: AXYL_06055Help
Entry
AXYL_06055        CDS       T01341                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:axy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:axy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6525525..6526661
Genome map
AA seq 378 aa AA seqDB search
MSAETPAVSVVTNAQRLVAKVGSSLVTNEGRGLDRAAVAHWAAQIAALHKQGKQIVLVSS
GAIAEGMARLGWRKRPSVMHELQAAAAVGQMGLCQAYEAAFAEYGLRTAQILLTHEDLAD
RHRYLNARSTLFALLRLGVVPIVNENDTVVTDEIRLGDNDTLGALVTNLIEADTLIILTD
QRGLYDSDPRKNPEAKFMSHAQAGDPALEAMAGGAGSGIGTGGMLTKVLAAKRAAHSGAH
TVIASGHERNVLTRLAQGECIGSELRAVLPVWSARKQWLADHLRLRGRVVLDDGAVQALL
REGKSLLPIGVTEVDGEFGRGDVVACVDGQGRECARGLINYSSADTRRILRQPSSQIARI
LGSMTEPELMHRDNLVVL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaacacccgccgtttccgtcgtcaccaacgcccagcgcctcgtcgccaaa
gtcggctcgtcgctggtcaccaatgaaggccgcggcctggaccgcgccgccgtggcgcac
tgggccgcgcagatcgccgccctgcacaagcagggcaagcagatcgtgctggtctccagc
ggcgccatcgcggaaggcatggcgcgcctgggctggcgtaaacgtccctcggtcatgcac
gaactgcaggccgccgcggccgtgggccagatgggcctgtgccaggcctatgaggcggct
ttcgccgagtacggcctgcgcaccgcccagatcctgctgacccacgaagacctggccgac
cgccaccgctacctgaacgcgcgcagcacgctgttcgcgctgctgcgcctgggcgtggtg
ccgatcgtgaacgaaaacgacacggtggtcaccgacgaaatccggctgggcgacaacgac
accctgggcgcgctggtcaccaatttgatcgaagccgacacgctgatcatcctgacggac
cagcgcggcctgtatgactccgacccgcgcaagaatcccgaggccaagttcatgtcgcac
gcccaggccggcgacccggcgctggaagccatggctggcggcgccggcagcggcatcggc
accggtggcatgctgaccaaggtgctggcggccaagcgcgcggcgcatagcggcgcgcat
accgtgatcgcgtcgggccacgaacgcaacgtgctcacgcgcctggcccagggcgagtgc
atcggcagcgaattgcgcgccgtgctacctgtgtggtccgcgcgcaagcaatggctggcc
gaccacctgcgcctgcgcggacgcgtggtgctggacgacggtgccgtgcaggctctactg
cgcgaaggcaagagcttgctgcccatcggcgtgaccgaggtggacggcgagttcggccgc
ggcgatgtggtcgcctgcgtcgatggtcagggccgcgaatgcgcccggggcctgatcaac
tactcatcggccgatacccgccgcatcctgcgccagccttcgtcgcagattgcgcgcatc
ctgggcagcatgaccgaacccgagctcatgcaccgagacaacctggtagtactctga

DBGET integrated database retrieval system