KEGG   Achromobacter xylosoxidans A8: AXYL_06070Help
Entry
AXYL_06070        CDS       T01341                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00260  Glycine, serine and threonine metabolism
axy00680  Methane metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
axy01230  Biosynthesis of amino acids
Module
axy_M00002  Glycolysis, core module involving three-carbon compounds
axy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_06070 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AXYL_06070 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_06070 (gpmA)
Enzymes [BR:axy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AXYL_06070 (gpmA)
Membrane trafficking [BR:axy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AXYL_06070 (gpmA)
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AXYL_06070 (gpmA)
  Exosomal proteins of melanoma cells
   AXYL_06070 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADP19363
UniProt: E3HLM8
Position
complement(6541440..6542192)
Genome map
AA seq 250 aa AA seqDB search
MHKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKKEGFTFDLAYSSLLKR
AIRTLWIALDAMDAMYTPVGVTWRLNERHYGALQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLPLDDERHPRFDKRYAKVPADQLPATECLKDTVERVLPFWNESIAPAIRAGRNVLIA
AHGNSLRALIKHLDNVSDEDIVNLNIPTGQPLVYELDDDLRPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatgcgccacggcgaaagccagtggaatctggaaaaccgcttc
accggctggaccgacgtcgacctcaccgagaccggccgcgaacaggcccgcaaggccggc
gaactgctcaagaaagaaggttttaccttcgacctggcctactcctcgctgctcaagcgc
gccatccgcaccctgtggatcgccctggacgccatggacgccatgtacaccccggttggc
gtgacctggcgcctgaacgaacgccactacggtgcgctgcaaggcttgaacaaggctgaa
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgccatcgcc
ccggaaccgctgcccctggacgacgaacgccatccgcgtttcgacaagcgctatgccaag
gtgccggctgaccagttgcccgccaccgaatgcctgaaggacacggtggagcgcgtgctg
ccgttctggaacgaatccatcgccccggccatccgcgccggccgcaatgtcctgatcgcc
gcccacggcaacagcctgcgcgccctgatcaagcacctggacaacgtctcggacgaggac
atcgtcaacctgaacattcctaccggccagccgctggtctacgaattggatgatgacctg
cgcccgatccgccactattatctgggcgatgccgccgagatcgaggcggccatggctgcg
gtggcagcccagggcaaggctaagaaggactga

DBGET integrated database retrieval system