KEGG   Achromobacter xylosoxidans A8: AXYL_06209Help
Entry
AXYL_06209        CDS       T01341                                 

Gene name
bdhA4
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:axy00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:axy00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6677550..6678335
Genome map
AA seq 261 aa AA seqDB search
MHNLNGKVAVVTGAASGIGKEIALTLARAGAAVAIADLNQAGADAVAREIEQAGGKAMGV
AMDVTSEDAVNQGIDRVAAAYGSIDILISNAGIQIVNPIENFAFSDWKKMQAIHVDGAFL
TTKAALKHMYKGDRGGVVIYMGSVHSHEASPLKSAYVAAKHALLGLARVLAKEGAAHNVR
SHVICPGFVRTPLVEKQIPEQAKELGISEEDVVKKVMLGDTVDGVFTTVEDVAQTALFLA
AFPSAAFTGQSFVVSHGWYMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcataacctgaatggaaaagtcgccgtcgtcaccggcgcagccagcggcatcggcaag
gaaatcgccctcaccctcgcgcgcgccggtgcggcagtcgccatcgcggatctgaaccag
gcaggcgccgacgccgtcgcccgcgaaatcgaacaggcgggcggcaaggccatgggcgtc
gccatggacgtcaccagcgaagacgccgtgaaccagggaatcgaccgcgttgccgccgcc
tacggcagcatcgacatcttgatctcgaacgcgggcatccagatcgtcaatcccatcgag
aacttcgcattctcggactggaagaagatgcaggccatccacgtggacggcgcattcctc
acaaccaaggcggcgctcaagcacatgtacaagggcgaccgcggcggcgtggtcatctat
atgggctcggtccattcgcacgaagcctcgccgctgaagtccgcctacgtggccgccaag
cacgccctgctaggcctggcgcgcgtgctggccaaggaaggcgcggcgcacaatgtgcgc
tcgcacgtcatctgcccgggtttcgtgcgcacgccgctggtggaaaagcagatccccgaa
caggccaaggaactgggcatcagcgaagaggacgtggtcaagaaggtgatgctgggcgac
acggtcgacggcgtcttcacgacggtcgaggacgtggcgcagaccgccctgttcctggcc
gccttccccagcgccgccttcacgggccagtccttcgtggtcagccacggctggtacatg
cagtga

DBGET integrated database retrieval system