KEGG   Achromobacter xylosoxidans A8: AXYL_06209Help
Entry
AXYL_06209        CDS       T01341                                 

Gene name
bdhA4
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AXYL_06209 (bdhA4)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AXYL_06209 (bdhA4)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AXYL_06209 (bdhA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6677550..6678335
Genome map
AA seq 261 aa AA seqDB search
MHNLNGKVAVVTGAASGIGKEIALTLARAGAAVAIADLNQAGADAVAREIEQAGGKAMGV
AMDVTSEDAVNQGIDRVAAAYGSIDILISNAGIQIVNPIENFAFSDWKKMQAIHVDGAFL
TTKAALKHMYKGDRGGVVIYMGSVHSHEASPLKSAYVAAKHALLGLARVLAKEGAAHNVR
SHVICPGFVRTPLVEKQIPEQAKELGISEEDVVKKVMLGDTVDGVFTTVEDVAQTALFLA
AFPSAAFTGQSFVVSHGWYMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcataacctgaatggaaaagtcgccgtcgtcaccggcgcagccagcggcatcggcaag
gaaatcgccctcaccctcgcgcgcgccggtgcggcagtcgccatcgcggatctgaaccag
gcaggcgccgacgccgtcgcccgcgaaatcgaacaggcgggcggcaaggccatgggcgtc
gccatggacgtcaccagcgaagacgccgtgaaccagggaatcgaccgcgttgccgccgcc
tacggcagcatcgacatcttgatctcgaacgcgggcatccagatcgtcaatcccatcgag
aacttcgcattctcggactggaagaagatgcaggccatccacgtggacggcgcattcctc
acaaccaaggcggcgctcaagcacatgtacaagggcgaccgcggcggcgtggtcatctat
atgggctcggtccattcgcacgaagcctcgccgctgaagtccgcctacgtggccgccaag
cacgccctgctaggcctggcgcgcgtgctggccaaggaaggcgcggcgcacaatgtgcgc
tcgcacgtcatctgcccgggtttcgtgcgcacgccgctggtggaaaagcagatccccgaa
caggccaaggaactgggcatcagcgaagaggacgtggtcaagaaggtgatgctgggcgac
acggtcgacggcgtcttcacgacggtcgaggacgtggcgcagaccgccctgttcctggcc
gccttccccagcgccgccttcacgggccagtccttcgtggtcagccacggctggtacatg
cagtga

DBGET integrated database retrieval system