KEGG   Achromobacter xylosoxidans A8: AXYL_06338Help
Entry
AXYL_06338        CDS       T01341                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXYL_06338 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXYL_06338 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    AXYL_06338 (glcB)
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AXYL_06338 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6810058..6812232
Genome map
AA seq 724 aa AA seqDB search
MTQRIQHHGLQVAANLNQFIEQEALPGTGLDADGFWQGFAALVDDLAPKNRALLAERDRL
QAELDAWHRAHPGPIADPAAYRKFLEGIGYLLPQPASVRATTENVDTEISQQAGPQLVVP
MSNSRYALNAANARWGSLYDALYGTDAIPATPGDTGHGYNPERGAAVIARARAFLDTAAP
LAQGSHADARGYTVENGQLRVALANGATGLKNPAQFAGYQGEASAPSAILLKNNGLHFEI
QIDRGHSIGATDAAGVKDVLVEAALTTIMDCEDSIAAVDADDKVHVYRNWLGLMKGDLTE
EVTKGGKTFTRKLNADRNYTRPDGSPLTLHGRSLMFVRNVGHLMTNPAILDREGREIPEG
ILDAVVTSLAALQDRQRKLNSRTGSVYIVKPKMHGPVEAAFASELFDRVEDLLKLPRNTL
KMGIMDEERRTSINLKACIEAAAARVAFINTGFLDRTGDEMHSSMEAGPMLRKGDMKSTA
WITAYERNNVLVGLDAGLRGRAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTA
ATLHALHYHQVDVQTVQQELERTKLDSVRDDLLGGLLTVPVGDPSKWSAQDIQQELDNNV
QGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVTNRDQVMETF
KRMAKVVDGQNAGDALYRPMAGNFDTSLAFKAACALVFEGLTQPNGYTEPLLHKYRLEFK
AAQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacgcatccagcaccacggcctgcaagtggcggccaatctcaaccaattcatc
gaacaggaagccctgcccggcaccggcctggatgccgacggcttctggcaaggcttcgcg
gccctggtggacgacctggcgcccaagaaccgcgcgctgctggccgaacgtgaccgcctg
caggccgagctcgacgcctggcaccgcgcccatcccggccccatcgccgatccggccgcc
taccgcaagttcctggaaggcatcggctacctgctgccgcagcccgccagcgtgcgcgcc
accaccgaaaacgtcgacaccgaaatctcgcagcaggccggcccgcagctggttgtgccc
atgtccaactcgcggtacgcgctgaacgccgccaacgcgcgctggggcagcctgtacgac
gcgctctacggcaccgacgccattcccgccacgcccggcgacacggggcacggctacaac
ccggaacgcggcgccgccgtcatcgcccgcgcccgcgccttcctcgacaccgccgctccg
ctggcccagggctcgcatgccgacgcccgcggctataccgttgaaaacggccaattgcgc
gtggcgctggccaacggcgccacaggtctgaagaaccccgcgcagttcgccggctaccag
ggcgaggcgtccgccccctcggccatcctgctcaagaacaacggcctgcacttcgaaatc
cagatcgaccgcggccacagcatcggcgccaccgacgccgcaggcgtcaaggacgtgctg
gttgaagccgcgctcaccaccatcatggactgcgaggactccatcgccgccgtggacgcc
gacgacaaggtccacgtctaccgcaactggctcggcctgatgaagggcgacctgaccgag
gaggtcaccaagggcggcaagaccttcacccgcaagctcaacgccgaccgcaactacacg
cgccccgacggttcgccgctgaccctgcacggccgttcgctcatgttcgtgcgcaacgtc
ggccacctgatgaccaacccggccatcctggaccgcgaaggccgcgagatccccgaaggc
atcctggacgccgtggtcaccagcctggccgccttgcaagaccgccagcgcaagctgaat
tcgcgcactggctccgtctacatcgtgaagcccaagatgcacggcccggtcgaagccgcc
ttcgccagcgaattgttcgaccgtgtcgaagacctgctgaagctgccgcgcaacaccctg
aaaatgggcatcatggacgaagagcgccgcaccagcatcaacctcaaggcctgcatcgag
gccgccgccgcgcgcgtggccttcatcaacacgggcttcctggaccgcaccggcgacgaa
atgcactccagcatggaagccggcccaatgctgcgcaagggcgacatgaagtccaccgcc
tggatcaccgcctacgagcgcaacaacgtgctggtcgggctggacgcgggtttgcgcggc
cgcgcccagattggcaagggcatgtgggccatgccggacctgatggccgcgatgctggaa
cagaagatcgcccatcccaaggcgggcgccaacaccgcctgggtgccctcgcccaccgcc
gccacgctgcatgcgctgcactatcaccaggtcgacgtgcagaccgtgcagcaagaactg
gagcgcaccaagctcgacagcgtgcgcgatgatttgctgggcggcctgctgaccgtgccg
gtcggagacccgtccaagtggtccgcgcaggacatccagcaggaactggacaacaacgtc
cagggcatcctgggctacgtggtgcgctggatcgaccaaggcgtaggttgctccaaggtg
ccggacatccacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagccag
cacatcgccaactggctgcgccacggcgtgaccaaccgcgaccaagtcatggaaaccttc
aagcgcatggccaaggtggtcgacggccagaacgcgggcgacgcgctctatcgtccgatg
gccggcaacttcgacacgtcgctggcgttcaaggccgcctgcgccctggtgttcgaaggc
ctgacccagcccaacggctacaccgagccgctgctgcacaagtaccgcctggagttcaag
gccgcccaggcctga

DBGET integrated database retrieval system