KEGG   Ilumatobacter coccineum: YM304_04450Help
Entry
YM304_04450       CDS       T02501                                 

Definition
putative ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
aym  Ilumatobacter coccineum
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aym03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aym03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aym03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:aym03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485317..486330
Genome map
AA seq 337 aa AA seqDB search
MEEARRFVIQQHDATRLHWDLRLEHEGVLLSWALPRGVPWNPKENRLAVQTEDHSLDFLD
REGDDFDGRFGAGRSTQWDTGTYELHKIEPSKDDPTGAPVKLVVTLHGRRVSGKYSLFSM
RGSRDWLIHRMDPPDDEHRKPVPIGVRPMIATPGEMPVDSPSDWSYETRWNGIRAIVTDD
TGRVLITGADAADISIHFPEIRRIGRALGHREVILDGMIVPVDPTTGTVLHDRAGLTRRL
NITSDSGARNAAKTAPVVFMAFDILWIEGRPITDLPWELRRRQLDDLRLDGPGWRTSPSL
SVDEAYGAIDAETGIVAKRRDSVYTIDRPTPDWIDTA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaggcgcggcgattcgtgatccaacagcacgatgcgacgcgccttcactgggac
ctgcgactcgagcacgagggagtcctgctgtcgtgggcgctcccgcgaggtgtgccgtgg
aacccgaaggagaatcggctcgcggtgcagaccgaggatcactcgctcgacttcctcgac
cgcgagggcgacgacttcgacggtcggttcggcgccggccgcagcacgcagtgggacacc
ggcacctacgaactccacaagatcgaaccgtcgaaggacgaccccaccggcgcgccggtg
aagctggtcgtcacactccacggccgccgcgtctccggcaagtattcgctgttctcgatg
cgcggctcacgcgactggttgatccaccggatggacccacccgacgacgaacaccgcaag
ccggtgccgatcggtgttcggccgatgatcgcgaccccgggcgagatgcccgtcgactcg
ccgagcgactggtcgtacgagactcgttggaacggcatccgggccatcgtcaccgacgac
acgggccgtgtgttgatcaccggtgccgacgccgccgacatctcgatccacttccccgag
atccgccggatcggtcgagcgctcggccaccgcgaggtgatcctcgacggaatgatcgtg
cccgtcgacccgacgaccggcaccgtgctccacgatcgtgcaggcctcacacgacggctg
aacatcacgagcgacagcggtgcacgcaatgccgccaagaccgcgcccgtcgtgttcatg
gcgttcgacatcctctggatcgagggacgaccgatcaccgacctcccgtgggagctgcgc
cgtcgccaactcgacgatctccgcctggacggccctggctggcgcaccagtccgagcctc
agcgtcgacgaggcgtacggcgcgatcgatgccgagaccggcatcgtcgccaagcgccgc
gactccgtctacacgatcgaccggccgacccccgattggatcgacacggcctga

DBGET integrated database retrieval system