KEGG   Ilumatobacter coccineus: YM304_04450Help
Entry
YM304_04450       CDS       T02501                                 

Definition
(RefSeq) putative ATP-dependent DNA ligase (EC:6.5.1.1)
Organism
aym  Ilumatobacter coccineus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485317..486330
Genome map
AA seq 337 aa AA seqDB search
MEEARRFVIQQHDATRLHWDLRLEHEGVLLSWALPRGVPWNPKENRLAVQTEDHSLDFLD
REGDDFDGRFGAGRSTQWDTGTYELHKIEPSKDDPTGAPVKLVVTLHGRRVSGKYSLFSM
RGSRDWLIHRMDPPDDEHRKPVPIGVRPMIATPGEMPVDSPSDWSYETRWNGIRAIVTDD
TGRVLITGADAADISIHFPEIRRIGRALGHREVILDGMIVPVDPTTGTVLHDRAGLTRRL
NITSDSGARNAAKTAPVVFMAFDILWIEGRPITDLPWELRRRQLDDLRLDGPGWRTSPSL
SVDEAYGAIDAETGIVAKRRDSVYTIDRPTPDWIDTA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaggcgcggcgattcgtgatccaacagcacgatgcgacgcgccttcactgggac
ctgcgactcgagcacgagggagtcctgctgtcgtgggcgctcccgcgaggtgtgccgtgg
aacccgaaggagaatcggctcgcggtgcagaccgaggatcactcgctcgacttcctcgac
cgcgagggcgacgacttcgacggtcggttcggcgccggccgcagcacgcagtgggacacc
ggcacctacgaactccacaagatcgaaccgtcgaaggacgaccccaccggcgcgccggtg
aagctggtcgtcacactccacggccgccgcgtctccggcaagtattcgctgttctcgatg
cgcggctcacgcgactggttgatccaccggatggacccacccgacgacgaacaccgcaag
ccggtgccgatcggtgttcggccgatgatcgcgaccccgggcgagatgcccgtcgactcg
ccgagcgactggtcgtacgagactcgttggaacggcatccgggccatcgtcaccgacgac
acgggccgtgtgttgatcaccggtgccgacgccgccgacatctcgatccacttccccgag
atccgccggatcggtcgagcgctcggccaccgcgaggtgatcctcgacggaatgatcgtg
cccgtcgacccgacgaccggcaccgtgctccacgatcgtgcaggcctcacacgacggctg
aacatcacgagcgacagcggtgcacgcaatgccgccaagaccgcgcccgtcgtgttcatg
gcgttcgacatcctctggatcgagggacgaccgatcaccgacctcccgtgggagctgcgc
cgtcgccaactcgacgatctccgcctggacggccctggctggcgcaccagtccgagcctc
agcgtcgacgaggcgtacggcgcgatcgatgccgagaccggcatcgtcgccaagcgccgc
gactccgtctacacgatcgaccggccgacccccgattggatcgacacggcctga

DBGET integrated database retrieval system