KEGG   Ilumatobacter coccineum: YM304_09340Help
Entry
YM304_09340       CDS       T02501                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aym  Ilumatobacter coccineum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aym00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1030498..1031871)
Genome map
AA seq 457 aa AA seqDB search
MTDQRAGRVAVIGGGITGAAAAFEAASSAESVTLFEADDRVGGKMASTPFAGVAHVDAAA
DAFLARVPDAVALAAEVGIGDELVHPEKVGAAVWYDRMHDIPDGLVLGVPGNPFALARSG
LLTWRGKARAALEPFLPRTSLAPDSIGAFVRARFGDEVHERLVDALVGSIYAADTDRFSL
AEIPQLAALSSHRSLLLGARKIAAKNAGTASATAAPIFAAPAGGMPRLTDATVEAARQRG
ADVRLGASVTAEPDDSRWRVAGDVFDAVVIAAPPRTLVSTLPGADLGAAIESASADVVMV
TLHVDDGEWPERFTGRSGYLVPKPVQRDVTAVSFGSQKWAHWTPPSGGQVLRVSVGRDGA
PVLHLSDDEIVERVLADLDRHLGVAFSPLEVRITRWPGAFAQYRPHHRARVDDLRSHLPD
GIFVAGAGYDGIGIPACIRSGRTNAEHAVRHARTLAS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcagcgagcaggacgcgtcgccgtcatcggtggcggcatcaccggtgcggcc
gctgccttcgaggccgcctcgtcggccgagtcggtcaccctgttcgaagccgatgatcgt
gtcggcggcaagatggcctccacaccgttcgccggtgtcgcccatgtcgatgccgcagcc
gacgcgttcctcgcccgggtgcccgatgccgtcgcgttggccgccgaggtcgggatcggc
gacgaactcgtccaccccgagaaggtcggcgccgcggtctggtacgaccgcatgcacgac
atccccgacggtttggtgctcggcgtgccgggcaacccgttcgcgctcgcccgcagcggc
ctgctcacctggcgcggcaaggcccgcgccgcactcgaaccgttcctgccgcgcacctcg
ctcgctcccgacagcatcggcgcgttcgtgcgggcccgcttcggtgacgaggtccacgaa
cgcctcgtcgacgcgttggtcggcagcatctacgcggccgacaccgaccggttcagcctc
gccgagatcccgcaactcgccgcgctgagttcgcatcggagcttgctgctcggcgctcgc
aagatcgctgcgaagaacgccggcaccgcgtcggccacggccgcaccgatcttcgccgcg
cccgccggtggcatgccccgactgaccgacgccaccgtcgaggccgctcgccaacgcggg
gccgacgtccgcctcggagcatcggtgaccgctgagcccgacgactctcggtggcgggtg
gccggcgacgtgttcgacgccgtggtgatcgccgccccgccccgcacgctggtgagcacg
ctgcccggcgccgatctgggagcagcgatcgagtccgcgtcggccgacgtggtgatggtg
accctgcacgtcgacgacggcgagtggcccgaacggttcaccggccgcagcggctacctg
gtgcccaagccagtgcagcgcgacgtgaccgccgtgtcgttcggttcgcagaagtgggcg
cactggacgccgccgtcgggtgggcaggtcctccgcgtgtcggtcgggcgtgacggcgct
ccggtgctgcacctctccgacgacgagatcgtcgaacgagtgctcgccgacctcgaccgc
cacctcggcgtggcgttcagcccactcgaagtccgcatcacccggtggcccggagccttc
gcccagtaccggccgcaccaccgggcacgggtcgacgatctgcgcagccatctgcccgac
gggatcttcgtggccggcgccgggtacgacggcatcggcattccggcgtgcatccgcagc
gggagaacaaatgcggaacacgcggtccgccacgcacgaactctggcatcatga

DBGET integrated database retrieval system