KEGG   Ilumatobacter coccineum: YM304_18680Help
Entry
YM304_18680       CDS       T02501                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase/DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aym  Ilumatobacter coccineum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aym03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2073481..2074317
Genome map
AA seq 278 aa AA seqDB search
MPELPEVETVRRGLDRHARGRRIERVEVGRERVVRRTSREALVDGLTNTRIERTDRRGKY
LLLPLDSGDVAMIHLRMSGQVLIADGGAARPAHTHVVMHLDNDSELWFVDPRTFGEVVVF
APDRVDVELPELAKLGIDPIAEPFAKAQLSAIVRSTARALKPLLLDQHKIAGIGNIYADE
ILHAARLRPDRPANTLDARAITRLHLAIVDVLSAAIAAGGSTLGDAQYVDLMGEGGSYQD
DHRVYARGGERCLTCGRGWIRRTVSGGRGTHYCPVCQY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcccgaagtcgaaacagtccgccgtggactcgaccgccacgcacgaggc
cgccgcatcgagcgggtcgaggtcggacgcgaacgagtcgtgcggcgcacgtcgagagag
gcgctcgtcgacgggttgacgaacacccgcatcgagcgcaccgatcggcgcggcaaatac
ctgctgttgccgctcgactcgggcgatgtcgcgatgatccacctgcgtatgagcggccag
gtcctcatcgccgatggtggcgcggcccgccccgctcatacgcatgtggtgatgcacctc
gacaacgactccgagctgtggttcgtcgacccccgaacgttcggtgaagtggtcgtgttc
gctcccgaccgcgtcgacgtcgagctccccgaactcgccaagctgggaatcgatccgatc
gccgaacccttcgcaaaggcccagctcagtgccatcgttcggtcgacggcgagagcgctc
aagccgctactcctcgaccagcacaagatcgccgggatcggcaacatctacgccgacgag
atcctccacgcggcacggctgcgtcccgatcgaccggccaacacgctcgacgctcgagcg
atcacgaggctccatctggcgatcgtcgacgtgctgtcggcggccatcgccgcgggcggc
tccaccctgggtgacgcccagtacgtcgacctgatgggcgagggcggctcgtaccaggac
gaccaccgtgtctacgcccgcggcggtgaacggtgcctcacgtgcggtcgagggtggatc
cggcgcacggtgagcggcggccgcggcacgcactactgcccggtctgccagtactga

DBGET integrated database retrieval system