KEGG   Ilumatobacter coccineum: YM304_23440Help
Entry
YM304_23440       CDS       T02501                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aym  Ilumatobacter coccineum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YM304_23440 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YM304_23440 (proB)
Enzymes [BR:aym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YM304_23440 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2616921..2618027
Genome map
AA seq 368 aa AA seqDB search
MRIVAKIGTASITTDAGVIDTAAIARLADEVAALKAGGHDVIVVSSGAVAAGLAVLDMTQ
RPSDIQTVQAVSAVGQSRLVEAYNIEFARHSLIGAQLLVDSMDFVERTQYLHLRTTIDRL
LDLGCVPIVNENDAIANDELRYGDNDRIAAMIANSVNADVLVLLTDMDGVFTADPRTDST
ATLIPFIRADDPLLSISADSGGSGRGSGGMASKLTAARMASWSGVRCVIARAARRGVLQG
AVSDELVGTTFAPHERTLSARKLWIAFAAEVAGVVQVDEGARQALIDRPNSLLPAGVVAA
TGDFAARDVVDVVSADGEVFARGIASMSAAAVSEFGGRRTADIPEGYNEVVHRDDLVVLS
LGLSAARR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgtcgcgaagatcggtacggcgtcgatcacgaccgatgccggcgtgatcgac
accgcagcgatcgcgcgcctcgccgacgaggtcgccgcgctgaaggccggcgggcacgac
gtgatcgtcgtgtcgtcgggtgcagtcgctgccggactcgctgtgctcgacatgacgcaa
cggccgtccgacatccagacggtgcaggcggtgtcggcggtcggtcagagccgtctggtc
gaggcgtacaacatcgagttcgcccgacactcgctcatcggcgcccaactgctcgtcgac
tcgatggacttcgtcgagcgcacgcagtacctgcacctgcgcaccacgatcgaccggttg
ctcgatctcggctgcgtgccgatcgtcaacgagaacgacgccatcgccaacgacgaactc
cgctacggcgacaacgaccggatcgcggcgatgatcgcgaacagcgtcaacgccgacgtg
ctggtgttgctcaccgacatggacggtgtgttcaccgctgatccccgaaccgactcgacg
gcgacgctcatccccttcatccgagccgacgacccgttgctgtcgatctcggccgactcg
ggtggcagcggacgggggagtggcggcatggcgagcaagctcaccgctgctcgcatggcc
tcgtggtcgggcgtgcggtgcgtgatcgcccgagccgcccggcgtggcgtgctgcaaggt
gcggtgtcggacgagctcgtcggcaccacgttcgctccgcacgaacgcacgctgtcggct
cgcaagctctggatcgcgttcgccgccgaagtggccggcgtggtgcaggtcgacgagggt
gctcgtcaggcgttgatcgatcggcccaacagcttgctgcccgcgggcgtggtggcagcg
accggagacttcgccgcacgcgacgtggtcgacgtggtgagtgccgacggagaagtgttc
gctcggggcatcgcgtcgatgtcggccgccgccgtcagcgagttcggtggtcgccgcacg
gccgacatccccgagggctacaacgaggtcgtccatcgtgacgacctcgtcgtgctctca
ctcggtctgagcgccgcacggcgctga

DBGET integrated database retrieval system