KEGG   Ilumatobacter coccineus: YM304_30130Help
Entry
YM304_30130       CDS       T02501                                 

Definition
putative phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
aym  Ilumatobacter coccineus
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    YM304_30130
Enzymes [BR:aym01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     YM304_30130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3366348..3367658
Genome map
AA seq 436 aa AA seqDB search
MPERPTVYVGMSADLIHPGHINVLEQAAQHGSVTVGLLTDSAVASYKRLPHMTYDQRRVV
VENLKTVDRVVPQETLDYVPNLESLRPDIVVHGDDWQTGVQRATRQRVIDALAQWGGKLV
EVPYTEGISSTQLNASVKQIGTTPSVRLSRLRRLIDSKDIVRIMEAHSGLSGLVVENTKA
ERDGRTVEFDGMWSSSLTDSTSRGKPDIEAVDISSRLQTINEIFEVTTKPLIFDGDTGGK
PEHFSFTVRSLERLGVSAVIIEDKEGLKRNSLFGNDVAQTQSSIADFSERLRIGKLAQIT
EDFMVIARIESLILEAGMADAVERAEAYIDAGADAIMIHSRQKSPDEIFEFCDHAAKFSK
SVPIVAVPTSYHQVTEQELADRGVNVVIYANHMLRSAYPQMNKVATTVLENSRALEADPY
LSSINEVLTIIPENHS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacgccccaccgtatacgtcggaatgagcgcagacctcatccaccccggtcac
atcaacgtgctcgaacaggctgctcagcacggcagcgtgaccgtcgggctgttgacggat
tcggcggtcgcgtcgtacaagcggctcccccacatgacctacgaccaacggcgcgtcgtg
gtcgagaacctcaagaccgtcgatcgggtcgtcccgcaggaaaccctcgactacgtgccg
aacctcgagagcttgcgtcccgacatcgtcgtgcacggcgacgactggcagaccggcgtg
cagcgggcgacgcgccagcgtgtcatcgacgcactcgcccagtggggcggcaagctcgtc
gaggtcccctacaccgagggcatctcgtcgacgcagctcaacgcgtcggtcaagcagatc
ggcaccaccccgagcgttcgactctcccgactgcgccggttgatcgacagcaaagacatc
gtacgcatcatggaagcccactccgggctctccgggctcgtcgtcgagaacaccaaggcg
gagcgagatgggcgcaccgtcgagttcgacggcatgtggtcgtcgtcgctcaccgactcg
acctcgcgcggcaagcccgacatcgaggcggtcgacatctcgtcgcgcctccagacgatc
aacgagatcttcgaagtcaccaccaagccgctcatcttcgatggcgacaccggtggcaag
cccgagcacttctcgttcaccgtccgctcgctcgagcgactcggtgtgtctgccgtcatc
atcgaagacaaagagggcctcaagcgcaactcgctcttcggcaacgacgtcgcccagacg
cagtcgagcatcgccgacttctcggagcggttgcgcatcggcaagctggcgcagatcacc
gaagacttcatggtgatcgcccgcatcgaatcgttgatcctcgaagccgggatggctgac
gccgtcgagcgggccgaggcctacatcgacgccggcgccgacgcgatcatgatccacagc
cgccagaagagccccgacgagatcttcgagttctgcgaccatgcagcgaagttctccaag
tcggtgccgatcgtggccgtgccgacgagttaccaccaggtgaccgagcaagagctcgcc
gatcgcggcgtcaacgtcgtgatctacgcgaaccacatgctccgttcggcgtacccgcag
atgaacaaggtggcgaccaccgtgctcgagaacagccgcgcgctcgaggccgacccgtac
ctctccagcatcaacgaggtactcaccatcattccggaaaaccactcgtga

DBGET integrated database retrieval system