KEGG   Ilumatobacter coccineus: YM304_31160Help
Entry
YM304_31160       CDS       T02501                                 

Definition
putative limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
aym  Ilumatobacter coccineus
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YM304_31160
Enzymes [BR:aym01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     YM304_31160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3481120..3481500)
Genome map
AA seq 126 aa AA seqDB search
MTPLETVNDFMKRFCSGDLDHACELVTDDVEYDNVPMGKNFGPEGIKAFAGGMTGGFDSV
EFIVEREAATGNIVMNERIDRFVRGEQVFDLAVVGVFEVTDDGKISLWRDYFDMGPVNEM
MAALAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacgccactcgaaacggtcaacgacttcatgaagcggttctgttcgggcgatctcgat
cacgcatgtgagctggtcaccgacgatgtcgagtacgacaacgtgccgatgggaaagaac
ttcggccccgagggaatcaaggcattcgccggcggcatgacgggcggcttcgactccgtc
gagttcatcgtcgaacgcgaagcagccaccggaaacatcgtgatgaacgagcgcatcgat
cggttcgttcgcggtgagcaggtgttcgacctcgcggtggtcggcgtgttcgaagtgacc
gacgacggcaagatctcgctctggcgcgactacttcgacatggggccggtcaacgagatg
atggcggccctcgccggctga

DBGET integrated database retrieval system