KEGG   Ilumatobacter coccineus: YM304_32550Help
Entry
YM304_32550       CDS       T02501                                 

Definition
putative sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
aym  Ilumatobacter coccineus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YM304_32550
Enzymes [BR:aym01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     YM304_32550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3624150..3625721
Genome map
AA seq 523 aa AA seqDB search
MTHAGMKASLPNRVMLNAYPDSIDGDLAGTVRMLQRPEFTDAFGLFYVLPSIFNSDLDRG
FSIIDYDLNSDLASAEDLAALDELGIMLKFDMVLNHLSVGSPQFQDLLKHGDDSAFRDFF
IDWNEFWEGEGELHADGHVVPSPEHLDRLFMRKPGLPILQVRFPDGSDRFYWNTFYQRVE
TIDGERSYLGQMDLNAESPRVWTFYRETFEKLARYGAKIVRLDAFAYLHKAVGDTNFFNT
PGTWDHLDRLRTISEENGLVLLPEIHGEYGTKIHEELSDRDYPVYDFFFPGLVIDAIDSA
SNTHLLRWIDEIIERDIATVNMLGCHDGIPVIDLKGGPTGQGLLPDATIEAMISRLLERG
GRVKNLYGADGTKVSYYQVNATFFSALGESDARLRLARAIQLFVPGTPQVWYLDLFAGAN
DVEAADRAGADGHKEINRTNLSAADVEAGLARPIVLDQLEMIRLRNASPAFDGRFEVVPT
DDTRLQLRWQNGSTVALLDADLATERFTITHEHDGHTEILGYD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacgcgggcatgaaggccagcctcccgaaccgcgtgatgctcaacgcgtacccg
gacagcatcgacggcgatctcgcgggcacggtgcggatgctccagcgacccgagttcacc
gacgcgttcggtctgttctacgtgctcccctcgatcttcaacagcgacctcgaccgagga
ttctcgatcatcgactacgacctgaactccgacctcgcgtcagccgaagacctcgcggcg
ctcgacgaactcgggatcatgctcaagttcgacatggtgctcaaccacctctcggtcgga
tccccgcagttccaggacctgctgaagcacggtgacgactctgcgttccgcgacttcttc
atcgactggaacgagttctgggagggtgaaggcgaactccacgcagacggacacgtcgtc
ccgtctcccgagcacctcgaccggttgttcatgcgcaagcccggcctgcccatcctgcag
gttcggttccccgacggctccgaccggttctactggaacaccttctaccaacgggtcgag
accatcgacggcgagcgctcctacctcggccagatggacctcaacgccgagtcacctcgg
gtctggacgttctaccgcgagacgttcgagaagctggcccgatacggcgccaagatcgtg
cgcctcgacgccttcgcgtacctccacaaggcggtcggtgacaccaacttcttcaatacc
cccggcacgtgggaccacctcgaccggctccggaccatctccgaagagaacggcctcgtc
ctgcttcccgagatccacggcgagtacggcaccaagatccacgaggaactgtcggatcgc
gactaccccgtctacgacttcttcttccccgggctcgtcatcgatgcgatcgattcggcg
agcaacacgcatcttcttcgctggatcgacgagatcatcgagcgcgacatcgccaccgtc
aacatgctcggttgccacgacggcattccggtgatcgacctcaagggcggtccgaccggt
cagggcttgctgcccgacgcgacgatcgaggcgatgatctcacggctcctggagcgaggc
ggcagagtgaagaacctctacggcgccgacggcacgaaggtctcctactaccaggtcaac
gccaccttcttcagcgcgctcggcgagagcgacgccaggctgcgcctcgcacgcgcgatc
caactgttcgtgcccggcaccccacaggtctggtacctcgatctgttcgccggcgccaac
gacgtcgaggccgccgatcgtgcaggcgccgacggccacaaggagatcaaccgcaccaac
ctgagcgccgccgacgtcgaagccggcctcgctcggccgatcgtcctcgaccaactggag
atgatccgtctccgcaacgcgtcccccgcgttcgacggccgcttcgaggtcgtgccgacc
gacgacactcgactgcagctgcgctggcagaacggctcgaccgtcgcactgctcgacgcc
gacctggcgaccgagaggttcacgatcacccacgaacacgacggccacaccgagatcctc
ggctacgactga

DBGET integrated database retrieval system