KEGG   Ilumatobacter coccineum: YM304_33870Help
Entry
YM304_33870       CDS       T02501                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aym  Ilumatobacter coccineum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aym00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aym00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aym00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3790601..3792727)
Genome map
AA seq 708 aa AA seqDB search
MDRGVMSKIVRLVQEHAEVVVDVSTGAPNIVHWGAPLGDHADADAIARALDRPVVHGSLD
TVAPITVVPEHGSGFPGRPGLNGRRGGGRSWAPRFVTQTHSHIGNTVIVDAIDEVAGLAL
TTNITLDHALRVNVTLENIGDRRYSLDSLVVTVPLPEHADELLTFDGRWAREFHPVRRDW
TSGSMLVENRRGRTSHEAVPTVFAGRRGFGEWHGDVWGVHVAWSGNHQLYAERLPDGRRY
VQGGELLHPGEVVLEPGDTYTTPDVVGVHSPDGLTAATWGYHRSIRSLRVHPTTPRPVLL
NTWEAVYFDHDIDRLRALASTAADLGIERFVLDDGWFGSRRDDRSGLGDWFVSDDVYPDG
LGPLIDHVTGLGMEFGIWVEPEMVNPDSDLFRDHPDWALVTPDYEPVLGRRQLVLDLANP
AAFDHVLGQLDALLRDHRISFVKWDMNRDHVHGSGVDGAAGSRAQTLAVYRLVDELRTRH
PTVEIESCASGGGRIDHEILRRTERVWTSDCNDALERQTIQRGASMLIPPEVMGAHIGPP
RAHTTGRTQTLSFRAATAMFGHLGVEWDITRLSDDESAGLRSVIAMYKEYRGLLHSGDVV
RFDTDEGYVAHGVYAPDRSEGIVSFAQLTTTQSLMSPPLRLPGLDAEESYRVEHLRLPRE
RWGSAGAQPGWLADKGGVVLTGRQLATHGIRPPTLHPESAVLFTLTRL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtggacaggggagtcatgtcgaagatcgttcgtctggtgcaagagcacgccgaagtcgtc
gtcgacgtgtcgaccggtgcgccgaacatcgtccactggggagcgccactcggtgaccac
gccgacgccgacgcgatcgctcgggcgctcgaccggccggtcgtgcacggcagcctcgac
acggtcgcgccgatcacggtggtgcccgagcacgggtcgggcttccccggtcgtcccgga
ctgaacggacgacgagggggcggccgctcgtgggcccccaggttcgtcacgcagacccac
tcgcacatcggcaacaccgtcatcgtcgacgccatcgacgaggtcgccggactcgcgctg
accaccaacatcaccctcgaccacgccctccgggtcaacgtcacgctcgagaacatcggc
gaccgtcgctactcgctcgactcgctcgtcgtcaccgtgccgctccccgaacacgccgat
gaactcctcacgttcgacggccggtgggcgcgcgagttccatcccgtccgccgagactgg
accagcgggtcgatgctcgtggagaaccggcgcggtcgaacgtcgcacgaggcggtgccg
accgtgttcgccggtcggcgcgggttcggcgagtggcacggtgacgtgtggggcgtccac
gtcgcctggtcgggcaaccaccagctgtacgccgaacggctgcccgacggtcggcgatac
gtccaaggcggcgagctgctccacccgggcgaagtcgtgctcgaacccggcgacacctac
accacacccgacgtcgtcggcgtccactcgcccgacgggctcacggccgccacatggggc
taccaccgctcgatccgcagcctccgtgtgcatcccaccacgccgcggcccgtgctgctc
aacacgtgggaagcggtctacttcgaccacgacatcgacagactccgcgcactcgcgtcg
accgctgccgacctcggcatcgaacgcttcgtcctcgacgacggttggttcggttcacgc
cgcgacgaccgcagcgggctcggcgactggttcgtctccgacgacgtgtaccccgacggg
ctcggcccgctcatcgatcacgtcaccggactcggcatggagttcggcatctgggtcgaa
cccgagatggtcaaccccgacagcgacctcttccgcgaccatcccgactgggcgctggtc
acgcccgactacgagccggtgctcggccggcggcaactcgtgctcgatctcgccaaccct
gccgccttcgatcacgtcctgggacaactcgacgcactcctgcgggaccatcgcatctcg
ttcgtcaaatgggacatgaaccgcgaccacgtccacggctcgggagtcgacggcgcagca
ggatcgcgggcgcagacgctggcggtgtaccggctcgtcgacgagcttcgtacccgccat
ccgacggtcgagatcgaatcgtgtgcgagcggtggcgggcggatcgaccacgagatcctt
cgccgcaccgagcgagtctggacgagcgactgcaacgacgcgctcgaacgccagaccatc
cagcgtggtgcctcgatgctgatcccgcccgaggtgatgggcgcccacatcggcccgccg
agggcgcacaccaccgggcgcacacagacgctgtcgttccgggcggcgaccgcgatgttc
ggtcacctcggcgtcgaatgggacatcacccgcttgtcggatgacgagtcggcgggtctg
cggtcggtcatcgcgatgtacaaggagtaccgcgggctgctgcacagcggtgacgtcgtc
cgcttcgacaccgacgagggatacgtcgcacacggtgtgtacgcgcccgatcgctcggag
ggcatcgtgtcgttcgcccaactcaccaccacgcagagcctgatgtcgccgccgttgcgg
ctgcccggcctcgacgccgaggagtcgtatcgcgtcgagcatcttcgactcccgcgcgaa
cgctgggggagcgccggcgcccagcccgggtggttggcggacaagggtggcgtcgtgctc
accggacgacagttggccacccacggcatccgacctccgaccctgcacccggagtcggcc
gtgctcttcaccctgaccaggctgtag

DBGET integrated database retrieval system