KEGG   Ilumatobacter coccineus: YM304_33890Help
Entry
YM304_33890       CDS       T02501                                 

Definition
putative acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aym  Ilumatobacter coccineus
Brite
Enzymes [BR:aym01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     YM304_33890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3793818..3794594)
Genome map
AA seq 258 aa AA seqDB search
MGMSDQTVMEGCEPFSHVGNGPVGVLVLHGFTGNPSSMTTQATAFAAADLHVEQPRLPGH
GTTLADMQTTDWSDWSGEAAAAYDRLAERAEQIVVIGLSMGGTLTLWTGLQRLDDPRLRG
LICVNAATMPQPADVVEMVQEMIDEGNEVMPGIGSDIADPDVVEIAYEGTPLRQLLSLTN
DGLAPIADRYGELQMPILIFSSTDDHVVPADNSAHLRDTAGGPVEFVTLERSYHVATQDY
DRDLISERSLEFIERVTD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggggatgagtgaccaaaccgtgatggaagggtgtgaaccgttttcgcacgtcggcaac
ggaccggtcggagtgctcgtcctccacggcttcaccggcaacccctcctcgatgaccacg
caggccaccgcattcgccgcggccgatctccacgtcgaacaaccccggctccccggacac
ggcaccacgctcgccgacatgcagaccaccgactggtccgactggtcgggggaagccgcc
gccgcgtacgaccggctcgccgagcgcgccgagcagatcgtcgtcatcggcctgagcatg
ggcggcacgctcaccctctggaccggactgcaacggctcgacgacccgcgcctgcgcgga
ctcatctgcgtcaacgcggccaccatgccgcagcccgccgacgtcgtcgagatggtgcag
gagatgatcgacgaaggaaacgaggtcatgcccggcatcggctccgacatcgccgacccc
gacgtcgtcgagatcgcctacgagggcacaccgctgcgtcaactgctgtcgctcaccaac
gacgggctcgcgcccatcgccgaccgctacggcgaactgcaaatgccgatcctgatcttc
tcgtcgaccgacgaccacgtcgtcccggcagacaacagcgcacacctccgagacaccgcc
ggcggccccgtcgagttcgtcacgctcgaacgcagctaccacgtcgccacccaggactac
gaccgcgacctcatcagcgagcgcagtctcgaattcatcgaacgagtcaccgactga

DBGET integrated database retrieval system