KEGG   Ilumatobacter coccineum: YM304_37830Help
Entry
YM304_37830       CDS       T02501                                 

Gene name
hemD
Definition
putative uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aym  Ilumatobacter coccineum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aym00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YM304_37830 (hemD)
Enzymes [BR:aym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YM304_37830 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4280079..4280834)
Genome map
AA seq 251 aa AA seqDB search
MEPDRPLLGCRVVVTRDEPGELGRLLLAAGAEIVHVPLIEIVEPVDGGAELRATLDDLAR
FDWLIVTSPAGALRVGEAAADHPHLRLASVGTATASRLAELAGRPVELVPKRQLAESLAA
AFVESQRNTSQRVLLALADRAGTDLARTLRDAGHDVTSVVAYRTLLRAPSADDLQRVADA
DAVAFASGSAAESWATSMSADALPELVVAIGPTTAATARQFGLKISSVAADHSLEGLVRE
LAVRWRQARSS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgatcgtccgcttctcggttgtcgtgtcgtggtcacccgcgacgaacccgga
gaactcggtcgcctcctgctcgcggccggcgccgagatcgtgcacgttccgctcatcgag
atcgtcgaacccgtcgacggtggggccgaactacgtgccacgctcgacgacctcgcgcgt
ttcgactggctgatcgtcacgtcgcctgcgggtgcgctgcgggtcggcgaggccgcggcc
gatcacccgcatctgcgtctggcctcggtcggcaccgccaccgcgtcgcggctcgctgag
ctcgccgggcggccggtcgaactcgtcccgaagcgacagttggccgagtcgctcgccgcc
gcgttcgtcgagtcgcagcgcaacacgtcgcaacgggtgctgctcgcgctcgccgaccga
gcgggcaccgacctcgcgcggaccctgcgcgatgccgggcacgacgtgacgagcgtggtc
gcctaccggaccttgctcagagcgccgtcggccgacgatctgcagcgagtcgccgacgcc
gacgcggtggcgttcgcgagcggttcggccgccgagagttgggcgacgtcgatgtcggcc
gacgcgctgcccgaactggtggtggcgatcggtccgacgactgcggcaacagctcgtcag
ttcggcctcaagatctcgtctgttgctgccgatcactctctcgaaggattggtgcgcgaa
ctcgcggtgcgctggcgtcaggccaggtcatcgtga

DBGET integrated database retrieval system