KEGG   Ilumatobacter coccineum: YM304_38960Help
Entry
YM304_38960       CDS       T02501                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aym  Ilumatobacter coccineum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aym01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aym00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4392908..4394230
Genome map
AA seq 440 aa AA seqDB search
MSVMRRQVWSSMDAEARASIMHRGLDDIFEPSLRASIGELIDDVRERGDAAVCDALGTFD
GIDVTPEGLRVTDDELDSAAVSDAVDAAIDDAMTHLRDFNEQQMARAADWSFESEPGLTV
GEKITPITSAGLFTPSGKASYPSVAYQLAVPAVVAGVPELALVVPPVPGGSGEVDAAVLV
VCRKLGIRNVFRVNGPAGIAALGFGTESIPQVRKIVGPGSPAVTIAQVEMQRHGVATMML
LGPTESMVVADDTADPVRLAADLLIEAEHGTDSSVVLVTTSATLADATDAELDRQIAELP
DVRATAARASLGPNGGCIVVDDLDVAVTIANEFAAEHLQVAVADDQIDRVVDGLVNAGEI
LIGQHTPFSAGNFVIGCPASLPTSGFAHVSSGITADTFLKRTAIARADERAAARMAPSVI
ALADHEGFPAHAAALHLRNR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgatgcgtcgtcaggtctggtcgtcgatggatgccgaggcgcgtgcctcgatc
atgcatcgcggactcgacgacatcttcgaaccgtcgctgcgcgcttcgatcggcgaactc
atcgacgacgtccgcgagcgcggtgacgccgcggtgtgcgacgcgctcggcacgttcgac
ggcatcgacgtcacacctgagggtctgcgtgtgaccgacgacgaactcgattcggctgcg
gtcagcgacgcggtcgacgccgcgatcgacgacgccatgacccacctgcgcgacttcaac
gagcagcagatggctcgcgccgccgactggagcttcgagtcggagccggggttgacggtc
ggcgagaagatcacaccgatcacgtccgccgggttgttcaccccgtcgggcaaggcgagc
taccccagcgtcgcctaccaactcgccgtgccggccgtggtggccggcgtgcccgaactg
gccctcgtcgtgccgcccgtccccggtggttcgggagaggtcgacgccgccgtgctcgtc
gtgtgtcgcaagctcggcatccgcaacgtgttccgcgtcaacggcccggccggcatcgcc
gcgctcggcttcggcaccgagtcgattccgcaagtccgcaagatcgtcggacccggctcg
cccgccgtgacgatcgcgcaggtcgagatgcagcgccacggcgtcgccaccatgatgctg
ctcggcccgaccgagagcatggtcgtcgccgacgacaccgccgacccggtgcggctcgcc
gccgacctgttgatcgaagccgagcacggcaccgactcgtcggtcgtcttggtcacgacg
tcggcaaccctcgccgacgccaccgacgccgaactcgaccggcagatcgccgaactcccc
gacgtgcgcgccaccgcggcgcgggcgtcgctcggtcccaacggcggttgcatcgtggtc
gacgatctcgacgtcgccgtcaccatcgccaacgagttcgccgccgaacacctccaggtc
gccgtcgccgacgaccagatcgatcgcgtcgtcgacggtctcgtcaacgccggcgagatc
ctcatcggccagcacacaccgttcagcgccggcaacttcgtcatcggctgcccggcgtcg
ctgccgacgagcggcttcgctcacgtgtcgtcgggcatcaccgccgacacgttcctgaag
cgcaccgccatcgcccgcgccgacgaacgagcggccgcccgcatggcaccgtcggtcatc
gcgctcgccgaccacgagggattcccggcgcacgccgcggccctccatctccgcaaccgc
tga

DBGET integrated database retrieval system