KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_130Help
Entry
AYWB_130          CDS       T00314                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156089..156286
Genome map
AA seq 65 aa AA seqDB search
MDVLKDVIYHIETHYIITIRASIPLYAFNGARKIKAMGVKMVLSGEGADEIFGGFLYFHK
APNTP
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggatgttttaaaagatgttatttatcacattgaaacgcattatattataactattcgc
gcatcaattcctttatatgcatttaatggcgctcgcaaaattaaagctatgggtgttaaa
atggttctttctggcgaaggtgctgatgaaatttttggaggttttctatatttccataaa
gctcctaatactccataa

DBGET integrated database retrieval system