KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_130Help
Entry
AYWB_130          CDS       T00314                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ayw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AYWB_130
Enzymes [BR:ayw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AYWB_130
Peptidases [BR:ayw01002]
 Cysteine Peptidases
  Family C44
   AYWB_130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156089..156286
Genome map
AA seq 65 aa AA seqDB search
MDVLKDVIYHIETHYIITIRASIPLYAFNGARKIKAMGVKMVLSGEGADEIFGGFLYFHK
APNTP
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggatgttttaaaagatgttatttatcacattgaaacgcattatattataactattcgc
gcatcaattcctttatatgcatttaatggcgctcgcaaaattaaagctatgggtgttaaa
atggttctttctggcgaaggtgctgatgaaatttttggaggttttctatatttccataaa
gctcctaatactccataa

DBGET integrated database retrieval system