KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_246Help
Entry
AYWB_246          CDS       T00314                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ayw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AYWB_246
Enzymes [BR:ayw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AYWB_246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255366..255773
Genome map
AA seq 135 aa AA seqDB search
MIKISFSKIISISNILKIWKLSHKRQIEIFHKALIMAIINVTSDSFSYGNQHFATQKAVK
HALCCLKEGADILDIGCEFTRPGATLITPLEEQKPILHVIKELSHHPKAIISVYTYHFQI
AKLAIKSGAHIINDV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatttcttttagtaaaataatttctatttcaaacatcctaaaaatatggaaa
ctgtctcacaaacgccaaattgaaatctttcataaagccttaattatggcaattattaat
gttacttctgattctttttcatatggcaaccaacattttgccactcaaaaagcagttaaa
catgctctttgttgtctcaaagaaggtgctgatatccttgatattggatgcgaatttact
cgcccaggagcaactctaattactcctttagaagaacaaaaacccattttgcatgttatt
aaagaattatcgcaccaccccaaagccattatctctgtttatacttatcattttcaaatt
gctaaattagccattaaatcaggagctcatattatcaatgatgtttag

DBGET integrated database retrieval system