KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_249Help
Entry
AYWB_249          CDS       T00314                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ayw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256611..256868
Genome map
AA seq 85 aa AA seqDB search
MKLKIKHMELLVPLTIDLDILFFGNHTCKNPKLTIPHPYMLERIFVLTFLADILPNQITQ
TKTILEWKNQLDQNAVKIIENNQWY
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaaataaaacacatggaattattggttccacttactattgatttagatatt
ttgttttttggtaatcacacttgtaaaaatcctaaattaactattcctcatccatatatg
ttagaaagaatttttgtccttacttttttagcagatattttgcctaaccaaataacacaa
accaaaactattttagaatggaaaaaccaattagatcaaaatgcagttaaaataattgaa
aataatcaatggtattaa

DBGET integrated database retrieval system