KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_431Help
Entry
AYWB_431          CDS       T00314                                 

Gene name
pepD
Definition
dipeptidase PepV (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ayw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AYWB_431 (pepD)
  Amino acid metabolism
   00300 Lysine biosynthesis
    AYWB_431 (pepD)
Enzymes [BR:ayw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AYWB_431 (pepD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(438575..439951)
Genome map
AA seq 458 aa AA seqDB search
MIDFKKEVLKRKDALIEALQTLLKINTELTTFDPNRTGAPFGKGNQQALNFMLDLGSQSG
FKTLNLEGYAGHIEYGDQKEWVGMIGHLDVVPAGTGWYYPPYEALIVDGTLYGRGTQDDK
GPTMAAFWALKILHELNLPLSKRIKLILGVDEETGFRCMKHYFKQIPELPVSGFVPDSHF
PAIYCEKGIGDLTFEGEVLDNRIVSIQSGQASNVVPDLAQAVLKFDPNYLDLFHNFVQTT
NIKATLETQGDLLKIEVHGISAHGSTPETGENALYDLMKVLKSLGIKNNLVDFFDQYLLD
SLDGKKLGINHFDEETYNLVCFSGVLKLENNQTFFTLNLRYPKGITFEKILFQLGKAANN
QHFCLKTTLHHPIMYIDPKSELMQTLLKVYQKHTNDLFSKPMCVGGGSFAKCAPNLVPFG
PTFVDEVSLIHQKNESISIDQLIALTAIYTEALYLLSL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttaaaaaagaggttttaaaaagaaaagacgccttaattgaggctttgcaa
acattattaaaaattaacaccgaacttactacttttgaccctaatagaacaggcgctcct
tttggaaaaggcaaccaacaagcccttaattttatgcttgatttgggatcccaaagcggc
tttaaaacccttaatttggaaggatacgctggtcatattgaatacggagaccaaaaagaa
tgggttggtatgattggtcatttggatgttgttcctgcaggaaccggctggtactatccg
ccttatgaggctttaattgttgatggcacactttatggcagaggaacacaagacgataaa
ggtcctacaatggcagctttctgggctttgaaaatattgcacgaactaaatttaccgctt
tccaaaagaattaaattaattttgggtgtcgatgaagaaactggatttcgttgtatgaaa
cactattttaaacaaattcctgaattacctgtatctggttttgttccggacagccatttt
cctgctatttattgcgaaaaaggaattggggatttgacttttgaaggtgaagttttagat
aatagaattgtaagcattcaaagcggacaagcctctaatgtagttcctgatttggcacaa
gcagttctaaaatttgatcctaattacctagatttattccataattttgttcaaactaca
aatatcaaagccacattagaaacccaaggagatttgttaaaaatcgaagtgcatggcatt
tctgctcatggttcgactcctgaaacaggggaaaatgccctttatgatttgatgaaagtc
cttaaatcattgggaattaaaaataatttggttgatttttttgaccaatatttgttagat
agtctggatggaaaaaaattaggcattaatcactttgatgaagaaacttataatttagtt
tgtttttctggagttttaaaattagaaaataatcaaaccttcttcactcttaatttaaga
tatcctaaaggaattacatttgaaaaaatcctttttcaattaggaaaagcagccaataat
caacatttttgcctcaaaactactcttcatcatcccattatgtatattgatcctaaaagt
gaattgatgcaaacgttattgaaagtttatcaaaaacacactaatgatttattttccaaa
cctatgtgtgttggtggtggttcttttgctaaatgtgctcctaatttagtaccttttgga
cccacttttgtcgatgaagtttccttaattcatcaaaaaaatgaatctatttcaattgac
caattaattgctttaactgccatttacacagaagctttatatcttttgtccctgtaa

DBGET integrated database retrieval system