KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_440Help
Entry
AYWB_440          CDS       T00314                                 

Gene name
pfkA
Definition
6-phophofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ayw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AYWB_440 (pfkA)
   01230 Biosynthesis of amino acids
    AYWB_440 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYWB_440 (pfkA)
   00030 Pentose phosphate pathway
    AYWB_440 (pfkA)
   00051 Fructose and mannose metabolism
    AYWB_440 (pfkA)
   00052 Galactose metabolism
    AYWB_440 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AYWB_440 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AYWB_440 (pfkA)
Enzymes [BR:ayw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AYWB_440 (pfkA)
Protein phosphatases and associated proteins [BR:ayw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AYWB_440 (pfkA)
Messenger RNA biogenesis [BR:ayw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AYWB_440 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451936..452922)
Genome map
AA seq 328 aa AA seqDB search
MKNKNQKTKENKKIAVLTSGGDAPGMNAAIRALVFESSKQGFEVFGVKDGYLGLFNNQIE
LLNPQTFPRVLNVSGTFLGTARFLDFPNNLDVRKQCAKNLKTLGIDKLVVIGGDGSYKGA
SKLNELGIKCVGLPATIDNDIYTTDFTIGFSTALNNIVDAIEKLRDTSVSHKRCSIIEVM
GRNKGDLALFGGLAAGVDVIVTRENLLSQQTICQKIKDLRQANKRHAIVVVTEHIFDVLS
LAKEVENYSGFETRAQVLGHIQRGGKPTAEDLLLAFRMGSYAVSLLQKNIFNCAVGTCGL
NLHYTTFGDLFEKTYEKNELFNVVSKLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaaccaaaaaacaaaagaaaacaaaaaaattgctgtgttaacttcaggt
ggcgatgctcctggaatgaatgcagctattcgtgctttagtttttgaaagttcaaaacaa
ggatttgaagttttcggcgtgaaagatggttatttagggctttttaataaccaaattgaa
ctcctaaatcctcaaacatttcctcgcgttcttaacgtatcaggtacttttttgggaact
gcgcgttttttagattttccaaataatttagatgtgcgcaaacaatgtgcaaaaaattta
aaaactttaggaattgataaattagttgtaattggtggtgatggctcttataaaggagca
tccaaattgaacgaacttggcatcaaatgcgtaggactgccagcaactattgacaatgat
atttacaccactgattttactattggatttagcactgccctcaataatattgtagatgcc
atcgaaaaattgcgcgatacttctgtttctcacaaacgatgcagtattattgaagttatg
ggtcgcaacaaaggagatttggctttatttggtgggcttgctgcaggagtagacgttatt
gttactcgcgaaaatcttttatcccaacaaactatttgccaaaaaattaaagatttgcgc
caagcaaacaaaagacatgctattgtagttgtcactgaacacatttttgatgttttaagt
ttagccaaagaggtagaaaattacagtggttttgaaactagagcccaagttttaggacac
attcaaagaggtggtaaaccaactgcagaagacttattacttgcttttagaatgggaagt
tatgccgtttctttattgcaaaaaaacatttttaattgtgctgttggcacttgtggactt
aatttgcattacactacttttggtgatctttttgaaaaaacttatgaaaaaaatgaatta
tttaatgtggtatctaaattgttgtaa

DBGET integrated database retrieval system