KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_549Help
Entry
AYWB_549          CDS       T00314                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ayw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AYWB_549 (tpiA)
   01230 Biosynthesis of amino acids
    AYWB_549 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYWB_549 (tpiA)
   00051 Fructose and mannose metabolism
    AYWB_549 (tpiA)
   00562 Inositol phosphate metabolism
    AYWB_549 (tpiA)
Enzymes [BR:ayw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AYWB_549 (tpiA)
Exosome [BR:ayw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AYWB_549 (tpiA)
  Exosomal proteins of bladder cancer cells
   AYWB_549 (tpiA)
  Exosomal proteins of melanoma cells
   AYWB_549 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(568722..569546)
Genome map
AA seq 274 aa AA seqDB search
MNYKPRTKVIAGNWKMHKCKDEALEFIQKVSLQVPDQTQVQTLIFPQLTLLDPLVQLQGA
NLQVGAQNMFYETEGAFTGEVSPQNLLSLGVKHVLLGHSERRTLFGETDQTVNLKLLSAL
KHKLVPTVCVGESLLTKENNQTQMFLDQQLTNIFAGVPEEALKNMIIAYEPVWAIGTGKS
ANPQDANKTIEQIREKVTALYSFQASCAIRIIYGGSLSVANIKSILEQPAIDGILAGKAS
LQTEDFLFFAQIASKQVLVSTKDIFQKNDCPFCY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaaccaagaacaaaagtgattgcaggtaattggaaaatgcacaaatgcaaa
gacgaagctctggaatttatccaaaaagtaagtttgcaagttcctgatcaaacccaagtc
caaactctaattttcccccaacttaccttattagatcccttagtacaattacaaggcgcc
aatttacaagtaggggctcaaaatatgttttatgaaaccgaaggcgcttttactggtgaa
gtttcaccgcaaaatttgctttcactaggtgtcaaacacgttttattaggacacagcgaa
agaagaactctttttggagaaactgatcaaacagttaatctaaaacttttatcggctctc
aaacacaaattagttcctactgtttgtgtgggtgaatcacttcttactaaggaaaacaac
caaactcaaatgtttttagaccaacaattaaccaacatttttgcaggcgttccagaagaa
gcattaaaaaacatgatcatcgcttatgaaccggtttgggcaattggtacaggcaaaagc
gcaaatccccaagatgctaacaaaaccattgaacaaatccgagaaaaagtcactgcactt
tattctttccaagcatcttgtgcaattagaattatttatggcggttcgttgtctgttgcc
aatattaaatctattttagaacaacccgctattgatggtattttagcaggaaaagcttcc
ctccaaaccgaggattttttattttttgctcaaatagcaagcaaacaagtcttagtttcc
actaaagatatttttcaaaaaaatgattgtcctttttgttactaa

DBGET integrated database retrieval system