KEGG   Aster yellows witches'-broom phytoplasma AYWB: AYWB_658Help
Entry
AYWB_658          CDS       T00314                                 

Gene name
ysdC
Definition
(GenBank) endo-1,4-beta-glucanase (EC:3.2.1.4)
Organism
ayw  Aster yellows witches'-broom phytoplasma AYWB
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(688668..689738)
Genome map
AA seq 356 aa AA seqDB search
MRMKMSDLVSLLKNLTMLNGIPGQEKAVANYVVNKIQNQVDSIQYDNLGSVIACKGKTGP
RIMFAAHLDEIGLIVKQITPEGFIKFQTLGGWFSQVMLAQVWQIHTDKGILKAVTGCKPP
HAMSFQDRNQVINTSSMYLDIGVANKEEALKLGVRVGDMVTPYIEFSTLGNSDYLLAKAL
DNRVGVAIVMQVLQNVNPTTHQFFGVFTTQEEVGLRGAQTSAHKVHPQIAIAVDTGIGND
VPGGEKEGHTLGKGPQVLVYDGGLVAHKGLRNFVLKIATENNIPVQEISGIGGRTDAATM
HLVREGAASLSFCVPVRYIHSHTSVVHKQDIINTIKLLTLLANQLDEKKINEILFQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaaaatgagtgatttagtttctttattaaaaaatttaacaatgttaaatggt
attccaggtcaagaaaaagcagttgctaattatgtagtgaacaaaattcaaaaccaagta
gattctatccaatatgataatttaggctccgtaattgcttgtaaaggaaaaacaggtcct
cgcattatgtttgcagcacatttggatgaaataggtttaatagttaagcaaattactcca
gaaggttttatcaaattccaaactcttggtggttggttttctcaagtaatgcttgctcaa
gtgtggcaaattcacactgataaaggcattcttaaagcagttactggttgtaaacctcca
catgccatgtcttttcaagatcgcaatcaagttattaacacttcttctatgtatttagat
attggagttgcaaacaaagaagaagctttaaaattaggcgttcgtgttggtgatatggta
actccttatatagaatttagtacacttggtaattctgattacctccttgcaaaagcccta
gataatcgcgtgggagttgcaattgtgatgcaagttttacaaaatgtcaatcctactacc
catcaattttttggtgtttttactacccaagaagaagtaggactacgcggagctcaaacc
agtgctcacaaagtacaccctcaaattgctattgctgttgatactggtattggaaatgat
gttccggggggcgaaaaagaagggcatactctaggaaaaggccctcaagttttagtttat
gatgggggcttagttgctcacaaaggattacgcaattttgttcttaaaatcgctaccgaa
aacaatatccctgtacaagaaataagtggaattggtggtagaaccgatgctgcaactatg
catttagtgcgtgaaggagcagcttccttatctttttgtgttcctgtacgctacattcat
tctcacacttctgtagtacacaaacaagacattataaacactataaaacttttaactttg
ttagcgaatcaattagacgaaaaaaaaattaacgaaattttatttcaataa

DBGET integrated database retrieval system