KEGG   Azoarcus sp. KH32C: AZKH_0662Help
Entry
AZKH_0662         CDS       T02502                                 

Gene name
dsbC
Definition
putative thiol-disulphide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aza  Azoarcus sp. KH32C
Brite
Enzymes [BR:aza01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AZKH_0662 (dsbC)
Secretion system [BR:aza02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AZKH_0662 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735547..736278
Genome map
AA seq 243 aa AA seqDB search
MAIEKLRAMVAALGTVAVVLPGVAYADEAAVKKAVEAFVGSPSAVESVAKVPYGGLYEVL
MKSGELVYTDDKVTFLLDGRVIDTKTRRDVTAARMAQLSAIDFGTLPLDQAIKQVRGNGS
RVLVTFEDPNCTYCKRLAKELTQVKNVTLYTFLYPILTPDSTEKSRTIWCSKDRAKAWND
WILEAKAPPSGPKCDSEVVDRNVELGRKLRINGTPTLFLADGRRIGGYVAAAQLEEALAG
VTK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaaaaactgcgcgcgatggtggctgcgctgggaacggtggcggtggtgctg
ccgggagtggcgtacgcggacgaggcggcggtgaagaaggccgtggaggcgtttgtcgga
tcgcccagcgccgtcgagtcggtcgccaaggtcccttacggcgggctgtatgaagtgctg
atgaagagcggggagctcgtttatacggacgacaaggtcacgttcctgctcgacggccgt
gtcatcgacaccaagacgcgtcgtgatgtcacggccgcacggatggcgcagttgtcggcg
atcgatttcggaacgctgccgctcgaccaggcgatcaagcaggtacggggcaatggctcg
cgcgtgctggtcaccttcgaggacccgaactgcacctactgcaagcgcctggcgaaagag
ctgacgcaggtgaagaacgtgacgctttataccttcctgtatccgatcctgacgccggac
tcgaccgagaagtcgcgcacgatctggtgttcgaaggaccgggccaaagcctggaacgac
tggattctcgaggcgaaggcgcctccttccgggccgaagtgtgatagcgaggtcgtcgac
cgcaacgtcgagttggggcgcaagctgcgcatcaacggaacgccgacgctcttcctcgcg
gacgggcgccggatcggcggttatgtcgctgcggcccagctggaggaggcgctcgcgggc
gtgaccaagtaa

DBGET integrated database retrieval system