KEGG   Azoarcus sp. KH32C: AZKH_0914Help
Entry
AZKH_0914         CDS       T02502                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aza  Azoarcus sp. KH32C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZKH_0914 (hemD)
Enzymes [BR:aza01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AZKH_0914 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997918..998697
Genome map
AA seq 259 aa AA seqDB search
MSELTAATLAGRHIVVTRPAGQADSLCEAIEGRGGIAIRFPVLAIGAVEDRAPLDEVTGR
LDEFDLAFFVSPNAVSHALDAVLSRRPWPASVKVATVGKGSERALAGFGFRDVIAPQEGF
DSEAVLALDAFQTAAVSGRKVVIFRGDGGRDLLGETLRARGAEVEYVTCYRRYCPEFDPS
PLLRLAAAGQLDAITLTSSEGVGNLVAMLGEGASVVLATVPVFAPHPRIVAHAAAAGFQR
VIETPAGDEGLIAALESHF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaattgacagcagctacgctggccggccgccatatcgtggtgacccggccggcc
gggcaggcggacagcctgtgcgaagccatcgaggggcgcggcgggatcgcgatccgtttt
ccggtgttggcgatcggcgcggtcgaggacagggcgccgctcgacgaggtcacggggcgt
ctcgatgaattcgacctcgccttcttcgtcagtccgaatgccgtaagccacgcgctggac
gccgtgctctcgcgccggccctggccggcgagcgtgaaggtcgcgaccgtcggcaagggc
agcgagcgggcgctggccggcttcggcttccgcgacgtcatcgcgccgcaggaaggcttc
gacagcgaagcggtgctcgcgctcgatgcattccagacggccgcggtatccggccgcaag
gtcgtgatcttccgcggtgatggcgggcgggacctcctcggcgagaccttgcgcgcacgc
ggtgccgaggtcgaatatgtgacctgctaccggcgctactgtccggagttcgatccgtcg
ccgctgctgcggctggcggcagcggggcagctcgatgcgattacgctgacgagcagcgaa
ggcgtcggcaacctcgttgcgatgctcggcgagggcgcgtccgtcgtgttggcgaccgtc
ccggtgttcgcgccgcatccacggatcgtcgcacacgccgccgcggcgggcttccagcgc
gtcatcgaaacgccggccggcgacgagggcctgatcgccgccctcgaatctcatttttaa

DBGET integrated database retrieval system