KEGG   Azoarcus sp. KH32C: AZKH_0914Help
Entry
AZKH_0914         CDS       T02502                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aza  Azoarcus sp. KH32C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aza00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997918..998697
Genome map
AA seq 259 aa AA seqDB search
MSELTAATLAGRHIVVTRPAGQADSLCEAIEGRGGIAIRFPVLAIGAVEDRAPLDEVTGR
LDEFDLAFFVSPNAVSHALDAVLSRRPWPASVKVATVGKGSERALAGFGFRDVIAPQEGF
DSEAVLALDAFQTAAVSGRKVVIFRGDGGRDLLGETLRARGAEVEYVTCYRRYCPEFDPS
PLLRLAAAGQLDAITLTSSEGVGNLVAMLGEGASVVLATVPVFAPHPRIVAHAAAAGFQR
VIETPAGDEGLIAALESHF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaattgacagcagctacgctggccggccgccatatcgtggtgacccggccggcc
gggcaggcggacagcctgtgcgaagccatcgaggggcgcggcgggatcgcgatccgtttt
ccggtgttggcgatcggcgcggtcgaggacagggcgccgctcgacgaggtcacggggcgt
ctcgatgaattcgacctcgccttcttcgtcagtccgaatgccgtaagccacgcgctggac
gccgtgctctcgcgccggccctggccggcgagcgtgaaggtcgcgaccgtcggcaagggc
agcgagcgggcgctggccggcttcggcttccgcgacgtcatcgcgccgcaggaaggcttc
gacagcgaagcggtgctcgcgctcgatgcattccagacggccgcggtatccggccgcaag
gtcgtgatcttccgcggtgatggcgggcgggacctcctcggcgagaccttgcgcgcacgc
ggtgccgaggtcgaatatgtgacctgctaccggcgctactgtccggagttcgatccgtcg
ccgctgctgcggctggcggcagcggggcagctcgatgcgattacgctgacgagcagcgaa
ggcgtcggcaacctcgttgcgatgctcggcgagggcgcgtccgtcgtgttggcgaccgtc
ccggtgttcgcgccgcatccacggatcgtcgcacacgccgccgcggcgggcttccagcgc
gtcatcgaaacgccggccggcgacgagggcctgatcgccgccctcgaatctcatttttaa

DBGET integrated database retrieval system