KEGG   Azoarcus sp. KH32C: AZKH_1598Help
Entry
AZKH_1598         CDS       T02502                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aza  Azoarcus sp. KH32C
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aza01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aza00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1789539..1790471)
Genome map
AA seq 310 aa AA seqDB search
MTNRNVSLIGVPTDVGAGVRGASMGPEALRVAGLGRAIAAFGVDVLDCGNLSGPNNPELP
AVNGFRHLAEVAAWNTILHEAVYAELHGGRLPIMMGGDHCLAIGSISAVARYCRETGKKL
RILWFDAHADLNTATMTPSGNIHGMPVACLCGHGPETLTRIGGHVPAMLPCDIRQVGIRS
VDEGEKTFLRELGVEVFDMRYIDEVGMRAVMEQALAGVDENTHLHVSLDVDFLDPTIAPG
VGTTVRGGPTYREAELCMEMIADTEQLASLDIVELNPALDHRNMTAELAVDLVESLFGKS
TLMRMHRHTT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccggaatgtcagtctgatcggagttccgaccgacgtcggcgcgggcgtgcgc
ggcgcgagcatggggccggaggcgctgcgcgtggccggactcgggcgggcgattgccgcc
ttcggcgtcgatgtcctcgattgcggcaacctgagcggcccgaacaaccccgagttgccg
gcggtgaacggcttccgtcatctcgcggaagtggcggcatggaacacgatcttgcacgag
gccgtgtacgcagaactccacggcgggcgcctgcccatcatgatggggggggaccactgc
ctcgccatcggctcgatcagcgcggtcgctcggtattgccgggaaaccggcaagaagctg
cgcatactgtggttcgatgcccacgccgacctgaacaccgcgacgatgactccgtccggc
aacatccacggcatgccggtcgcgtgcctgtgcggccacggcccggagacgctcacgcgg
atcggcggccatgtccccgcgatgcttccctgcgacatccggcaggtcgggatccgcagc
gtcgacgaaggggaaaagaccttcctgcgcgaactgggcgtggaagtcttcgacatgcgc
tacatcgacgaagtcggcatgcgggcggtgatggaacaggccctcgcgggcgtcgatgag
aacacgcacctgcacgtcagcctggacgtcgacttcctcgacccgaccatcgcgcccggc
gtcggcaccacggtgcgcggcggaccgacctaccgcgaagccgaactgtgcatggaaatg
atcgccgacaccgagcaactggcgtcgcttgatatcgtcgagctcaatccggcgctcgat
catcgcaacatgaccgcggaacttgcggtggatctcgtcgaaagtctgttcggcaagagc
acgctgatgcggatgcatcggcacactacctga

DBGET integrated database retrieval system