KEGG   Azoarcus sp. KH32C: AZKH_1598Help
Entry
AZKH_1598         CDS       T02502                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00220  Arginine biosynthesis
aza00330  Arginine and proline metabolism
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01130  Biosynthesis of antibiotics
aza01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AZKH_1598
   00330 Arginine and proline metabolism
    AZKH_1598
Enzymes [BR:aza01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AZKH_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAL23919
UniProt: H0Q3H6
Position
complement(1789539..1790471)
Genome map
AA seq 310 aa AA seqDB search
MTNRNVSLIGVPTDVGAGVRGASMGPEALRVAGLGRAIAAFGVDVLDCGNLSGPNNPELP
AVNGFRHLAEVAAWNTILHEAVYAELHGGRLPIMMGGDHCLAIGSISAVARYCRETGKKL
RILWFDAHADLNTATMTPSGNIHGMPVACLCGHGPETLTRIGGHVPAMLPCDIRQVGIRS
VDEGEKTFLRELGVEVFDMRYIDEVGMRAVMEQALAGVDENTHLHVSLDVDFLDPTIAPG
VGTTVRGGPTYREAELCMEMIADTEQLASLDIVELNPALDHRNMTAELAVDLVESLFGKS
TLMRMHRHTT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccggaatgtcagtctgatcggagttccgaccgacgtcggcgcgggcgtgcgc
ggcgcgagcatggggccggaggcgctgcgcgtggccggactcgggcgggcgattgccgcc
ttcggcgtcgatgtcctcgattgcggcaacctgagcggcccgaacaaccccgagttgccg
gcggtgaacggcttccgtcatctcgcggaagtggcggcatggaacacgatcttgcacgag
gccgtgtacgcagaactccacggcgggcgcctgcccatcatgatggggggggaccactgc
ctcgccatcggctcgatcagcgcggtcgctcggtattgccgggaaaccggcaagaagctg
cgcatactgtggttcgatgcccacgccgacctgaacaccgcgacgatgactccgtccggc
aacatccacggcatgccggtcgcgtgcctgtgcggccacggcccggagacgctcacgcgg
atcggcggccatgtccccgcgatgcttccctgcgacatccggcaggtcgggatccgcagc
gtcgacgaaggggaaaagaccttcctgcgcgaactgggcgtggaagtcttcgacatgcgc
tacatcgacgaagtcggcatgcgggcggtgatggaacaggccctcgcgggcgtcgatgag
aacacgcacctgcacgtcagcctggacgtcgacttcctcgacccgaccatcgcgcccggc
gtcggcaccacggtgcgcggcggaccgacctaccgcgaagccgaactgtgcatggaaatg
atcgccgacaccgagcaactggcgtcgcttgatatcgtcgagctcaatccggcgctcgat
catcgcaacatgaccgcggaacttgcggtggatctcgtcgaaagtctgttcggcaagagc
acgctgatgcggatgcatcggcacactacctga

DBGET integrated database retrieval system