KEGG   Azoarcus sp. KH32C: AZKH_2284Help
Entry
AZKH_2284         CDS       T02502                                 

Gene name
thlA
Definition
(GenBank) beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aza  Azoarcus sp. KH32C
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_2284 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    AZKH_2284 (thlA)
   00640 Propanoate metabolism
    AZKH_2284 (thlA)
   00650 Butanoate metabolism
    AZKH_2284 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    AZKH_2284 (thlA)
   00072 Synthesis and degradation of ketone bodies
    AZKH_2284 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZKH_2284 (thlA)
   00310 Lysine degradation
    AZKH_2284 (thlA)
   00380 Tryptophan metabolism
    AZKH_2284 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZKH_2284 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZKH_2284 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZKH_2284 (thlA)
Enzymes [BR:aza01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZKH_2284 (thlA)
Exosome [BR:aza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZKH_2284 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2586432..2587616
Genome map
AA seq 394 aa AA seqDB search
MTQREIYFVGAARTAIGTFGGTLKDVPLSVLATTAVRAALERSGVAPDRVGHVVMGNVVP
TEPRDAYLSRVAAMDAGIPQEVPAFNVNRLCGSGLQAIVSAAQTISLGDADVAVAGGAEA
MSRGPYLLPAARWGARMGDAQMVDYMVGILHDPWEGFHMGITAENVAARYGISRAMQDEL
ALESQRRAAHAIAEGRFAAQIVPVEVPSRKGPIAFDTDEHVRAEVSIEQLAKMKPVFKRD
GSVTPGNASGINDGAAAVVLAAAGAVQAMNLKPLARLVAYAHAGVEPAYMGIGPVPATRL
VLERAGLRAADLDVIESNEAFAAQACAVMRELDLDPARVNPNGSGISLGHPVGATGAILA
TKAIYELHRTGGRYALVTLCIGGGQGIAAIIERA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcgtgagatctacttcgtcggtgccgcgcgcaccgccatcggcaccttcggc
ggcacgctcaaggacgtgcccctgagcgtgctcgccaccacggcagtgcgcgcggcactc
gagcgcagcggcgtcgccccggacagggtgggccacgtggtgatgggcaacgtcgtcccc
accgaaccgcgcgacgcctacctttcccgcgtggcggcgatggacgccggcatcccgcag
gaagtgccggccttcaacgtcaatcggctgtgcggttcggggctgcaggcgatcgtgtcg
gcggcacagaccatcagtctcggtgacgccgacgtcgcggtcgccggcggtgcggaggcg
atgagccgcggtccctacctcctgccggcggcgcgctggggcgcgcgcatgggcgacgcg
cagatggtcgattacatggtcggcatcctccacgacccgtgggaggggttccacatgggc
atcaccgccgagaacgtcgcggcgcgctacggcatttcgcgcgcgatgcaggacgaactc
gcgcttgagagccagcgccgcgccgcgcacgccatcgccgaggggcgcttcgcggcgcag
atcgtgccggtcgaggtgccgtcgaggaaggggccgatcgccttcgataccgacgagcac
gtgcgcgccgaggtgagcatcgagcagctggcgaagatgaagccggtgttcaagcgcgac
ggctcggtcacccccggcaacgcctcgggcatcaacgacggcgcggccgccgtggtgctg
gccgcagcgggcgccgtccaggcgatgaatctcaagccgctggcccgcctggtggcgtac
gcccatgccggggtcgagcccgcctacatggggatcggaccggtgccggcgacacgcctg
gtgctcgaacgcgccggcctgcgcgccgcggatctggacgtcatcgagtcgaatgaggcc
ttcgcggcccaggcctgcgccgtgatgcgcgaactcgacctggatcccgccagggtcaat
cccaacggttccggaatttcgctgggtcatcccgtcggcgccaccggcgcgatcctcgcc
accaaggccatctacgaactgcaccgcacgggcgggcgctatgcgctggtgaccctgtgc
atcggcggcgggcagggcatcgccgcgatcatcgagcgcgcctga

DBGET integrated database retrieval system