KEGG   Azoarcus sp. KH32C: AZKH_2630Help
Entry
AZKH_2630         CDS       T02502                                 

Gene name
treY
Definition
bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
aza  Azoarcus sp. KH32C
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZKH_2630 (treY)
Enzymes [BR:aza01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AZKH_2630 (treY)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     AZKH_2630 (treY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2973759..2978894)
Genome map
AA seq 1711 aa AA seqDB search
MASDAVDALCRFLGIEPDYEDGEGRYAEVSRECKIALLEALGHPLDPKRPDEDAASRLEA
LRRQADSRVMPPMLVLEAAPLPLRLPVRFPAGLAGRTLWWRIALEQGGERQGQLTVDVLP
EAEAPGDAHVATEIALALSLPQGYHRLSLHERPASSTALAETMLAICPPSCKPAGADRLW
GPSVQVYALSSARSWGMGDFGDLRRLVDIAADAGAHFVGVNPLHALFPYAPEHANPYSPS
NREWLNVLYLDIESMRDFAECVAARERVASAGFRARLDALHETPLVDYAGVAATKLEVLE
LLYQHFRSLHLDRGTQRAGLFRDFQREGGRSLRLHALFDALQAHFRRLDPAIRGWTSWPE
AYRDAQGSAVEAFALENELRIEFFEYLQWQAEGQLQAVASRARARGMRVGLCRDLAMGVN
EAGSETWTRPTLHASGARAGAPPDESNPAGRDRGFPPVIPQRLADEAYAPFLAVLRANMR
HAGALRLERVTALMRLFWLPGGLRGAELECPGAYVASPMQDLLGLLSLESRSHNCVMIGE
GLGDAPPVIREGMARHGLLACRSLYFAHEYGDEGERTGILRPPQWPEATLAVVGTHKLPT
LRGYWSGHDLELRRTFGLYRTAEQHERQAARRREDCEALIAALRAEDLLATDAGIPPPDH
GAELAPAVYRFLARSPAAMLAVQLEDVLDQLESADFPGTTEEAHPNWRRKLEVELADLAV
DPRWLAVAAAIAAERPSTALPLSGGPPGFHPERADIPLATYRLQFNSDFGFAAAEAILPY
LAELGISHVYAAPFLKARPGSRHGYDIVDHHAVNPEVGSNEDFDRYCARLSGLALGQILD
IVPNHVGVGGDSNAWWLDVLENGPASTYAGYFDIDWDPPFPELRGKVLLPVLGDQYGREL
EAGALHLTFSPERGDFSVTYYEHRFPVDPCDYPLILAAGLPITDDGAGGVEFETLVAALR
RMPPRGTADTAGLDERRRDKETFKRHLAALHARSPELRARIASALATFNGEPGRPESFDA
LDRLLSRQAYRLASWRVAADDINYRRFFDINDLAALRMESDVVFEATHARIFDWIAQGRA
SGLRVDHADGLADPRGYFERLQARHAEIAPQTSGGPHTLYLVVEKIFGEFETLPTDWPVH
GTTGYRFAALCNNLFVDPTQESRLSRIYRAFTGESRSFSQVLLEAKHLIITHSLPGELSS
LAYLLYDIARYDRHTRDFTRSRLRSALAEVIAAFPVYRSYIDPQGVSASDRRHIERAVEE
AVSRGRAGDASVLRFVRGVLLSAPVEADEELRRLKLRFATRFQQFTAPVMAKAMEDTAFY
RYNRLVSLNDVGADPRNFGIGIDDFHVANERIAWNHPFSLLASSTHDSKRSEDVRARIDV
LSEMPGPWRLALRRWRRINERRKVRVNDAPAPSSNDEYLLYQTLLGIWPLAAPDEPALAE
LADRVEAFMLKAAREAKLHTSWMNPEPAYEAALSTFVRRLFGADGADAFLADFLPFQALV
ARFGILNSLNMLLVKLTAPGVPDIYQGCERWNFSLVDPDNRRAVDFETASRQLGSLRRDF
PEGAPPASLRAMLEAPEDGRLKLYLLWRTLAVRKRFEHTFRFGRYVPLDVEGPAAGHVLA
FARVLGKERIVVIATRLHFGLTHGNAALAAAQETWAGTFVTLPWRELRWREELTGGRQVA
ASIGRRPGIELAELFNPLPLALLVPNGSITS
NT seq 5136 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgacgccgtcgacgcgctgtgccgcttcctcggcatcgaacccgactacgag
gacggggagggccgctatgcggaggtctcccgggaatgcaagatcgccttgctggaggca
ctggggcacccgctggacccgaagcgtcccgacgaggacgcggcgtcccgcctcgaagcc
ctgcgccgacaggccgactcccgcgtgatgccgccgatgctcgtcctcgaggccgcgccg
ctcccgctgcgcctgccggttcggtttcccgccgggctcgccggacgcacgctgtggtgg
cggatcgcgctggagcaaggcggcgaacggcagggccagctgacggtggatgtcctgccg
gaagcggaagcccccggagacgctcacgtcgccaccgagatcgcgctggccctgagcctc
ccgcaaggctatcaccggctttcgctgcacgagcgcccggcctcgtcgacggctctcgcg
gaaacgatgcttgcgatctgtccgccctcgtgcaagcccgcgggcgccgacaggctgtgg
gggccctcggtacaggtctacgcgctgagctcggcgagaagctggggcatgggcgatttc
ggtgacctgcgccggctcgtcgatatcgcggccgacgccggcgcgcacttcgtcggcgtc
aatccgctgcacgcgctctttccgtacgcgcccgaacatgcgaacccgtacagcccctca
aatcgcgaatggctgaacgtcctctatctcgacatcgaatcgatgcgcgatttcgccgaa
tgcgtggcggcgcgcgagcgggtcgcgtcggccggattccgcgcccgtctggatgcgcta
cacgaaacgcccctggtcgattacgcgggcgtcgctgcgaccaagctcgaagtgctcgaa
ctgctctaccaacacttccgcagcctgcacctcgaccggggcacgcaacgcgcgggcctc
tttcgcgacttccagcgcgaaggcgggcgcagcctgcgccttcacgcgctgttcgacgca
ctgcaggcacatttccggcggctcgatcccgcgatccggggctggacgagctggcccgaa
gcgtatcgcgacgctcagggcagcgccgtcgaggctttcgcgctcgaaaacgagctgcgt
atcgagttcttcgaatacctccaatggcaagccgaaggacagttgcaggccgtcgcctcg
cgggcccgcgcacgcggcatgcgtgtcggcctgtgccgcgacttggccatgggcgtgaac
gaagccggctccgagacctggacgagaccgaccctccatgcatccggtgcccgcgccggt
gcgccgcccgacgaatcgaatcccgccgggcgggatcggggctttccgcccgtaatcccg
caacgactcgccgacgaggcctacgcccccttcctcgccgtgctgcgcgcgaacatgcgc
catgcgggcgcgctgcggctcgaacgcgtgacggcgctgatgcgcctcttctggctgccc
gggggcttgcgcggcgccgaactcgaatgccccggcgcctatgtcgcatctccgatgcag
gacctcctcggcctgctcagcctggaaagtcgcagtcacaactgcgtgatgatcggggag
ggtctcggcgacgccccgcccgtcatccgggaggggatggcccgccatggcctgctcgcg
tgccggtcgctgtatttcgcacacgagtatggcgacgaaggagagcgcacgggcatcctc
cgcccgccgcagtggccggaggccaccctcgcggtcgtcggcacacacaagctgccgacg
ctgcgcggctactggagcgggcacgacctcgaacttcgccggaccttcggtctgtaccgg
acggcggagcagcacgaacgccaggcggcgcgccggcgcgaggactgcgaggcgctgatc
gcggcgctgcgcgccgaagacctgctcgccaccgatgccggcataccgccacccgatcat
ggggccgaactcgcccccgcggtataccgctttctcgcgcgcagcccggcggcgatgctt
gccgtacagctcgaagacgtgctcgaccagctcgaatcggccgatttcccagggacgacc
gaagaggcccacccgaactggcgccgcaagctcgaagtggaactcgccgatctcgccgtc
gacccgcgctggcttgccgtcgccgccgcgatcgccgccgaacggcccagcactgccttg
ccgctgagcggcggtccgccgggattccaccccgagcgggccgacattccgctcgccacc
taccgcctccagttcaacagcgacttcggtttcgcggcggccgaagccatcctgccctat
ctcgccgaactcggcatcagccacgtctatgccgcccccttcctgaaggcgcggccgggc
agccgccacggctacgacatcgtcgaccaccacgcggtgaaccccgaggtcggcagcaac
gaggacttcgaccgctattgcgctcggctatccggactcgcactcggccagatcctggat
atcgttccgaaccacgttggcgttggcggcgactcgaacgcctggtggctggacgtgctc
gaaaacggtccggcgtccacgtacgcggggtacttcgacatcgactgggatccgcctttc
cccgaactgcgcggcaaggtgctgctgccggtgctcggcgaccagtacggacgcgaactc
gaagcgggcgcgctgcatctgacgttctcgcccgaacgcggcgatttcagcgtgacctac
tacgagcaccgtttcccggtcgatccctgcgactacccgctgatcctcgccgccgggctg
ccgatcacggacgacggggcagggggcgtcgaattcgagaccctggtcgcggccctacgc
cgcatgcctccacgcggcaccgcggacaccgcgggactcgacgagcgccgccgcgacaag
gaaaccttcaagcgccacctcgcggcgctccatgcacgctcgcccgagctgcgcgcccga
atcgcgtccgcgctggcgacgttcaacggcgagccgggccggcccgagagcttcgacgcg
ctggaccggctgctctcgcgccaggcctaccgcctcgcctcgtggcgcgtcgcggccgac
gacatcaattaccgccgcttcttcgacatcaacgacctcgcggcgctgcgcatggagtcc
gacgtggtgttcgaggccacgcacgcgcgcatcttcgactggatcgcccagggcagggcg
tccggcctgcgcgtcgaccacgccgacgggctggccgacccccgcgggtatttcgagcgc
ctgcaagcccgccatgccgagatcgcgcctcagacgtcgggcggcccgcatacgctatac
ctcgtcgtcgaaaagatcttcggagaattcgagacgctgccgacggattggcccgtgcat
ggcaccaccggctaccgcttcgcggccctgtgcaacaacctcttcgtcgatccgacgcag
gaatcgcgtctgtcgcgcatctaccgcgccttcaccggcgaatcgcgcagcttcagccaa
gtgctgctcgaagcgaagcacctgatcatcacccattcgctccccggcgaactctcgagc
ctcgcctacctcctgtacgacatcgcccgctacgaccggcacacccgcgacttcacccgc
agccgcctgcgcagtgcgctggccgaagtgatcgccgccttccccgtctatcgaagctac
atcgacccgcagggtgtgtcagcatccgatcgccgccacatcgagcgggcggtcgaggag
gcggtctcgcgcggccgggcaggcgatgcgagcgtgctgcgcttcgtgcgcggcgtgctg
ctttccgcgccagtcgaggccgacgaggaactgcgccggctgaaactgcgcttcgccacg
cgcttccagcaattcaccgcgccggtgatggcgaaggcgatggaggacaccgccttctac
cgctacaaccgcctggtctcgctcaacgacgtgggcgcagacccacgcaacttcggcatt
ggcatcgacgacttccacgtcgccaacgaacgcatcgcctggaaccatcccttcagcctg
ctcgcatcctccacgcatgacagcaagcgctcggaagacgtccgcgcgcgcatcgacgtg
ctctccgagatgcccggcccgtggcgccttgccctgcggcgctggcggcgcatcaacgaa
cgccgcaaggtccgcgtgaacgacgcccccgcgccttcgagcaacgacgaatacctgctt
taccagaccctgctcggcatctggccgctcgccgcacccgacgaacccgcactggcggag
ctcgccgaccgcgtcgaagccttcatgctcaaggccgcacgcgaggcgaagctgcacacg
agctggatgaaccccgagccggcctacgaggccgcactctccaccttcgtgcgccgtctc
ttcggtgcagacggcgcggatgccttcctcgccgattttctccccttccaggcgctcgtt
gcgcgcttcggcatcctcaacagcctcaacatgctgctggtgaagctcaccgcgccgggc
gtgcccgatatctaccagggctgcgaacgctggaacttcagcctcgtcgatccggacaac
cgccgcgccgtggacttcgagacggcgagcagacagctcggctcgctgcgccgcgatttt
cccgaaggcgccccacccgcgtccctacgtgcgatgctcgaagcccccgaggacggccgc
ctcaagctctacctgctgtggcggaccttggcggtgcgcaagcgcttcgaacacaccttc
cgcttcggtcgctacgtgccgctcgacgtcgaagggcccgcggccggccatgtgctcgcc
tttgcccgcgtgctcggcaaggagcggatcgtcgtgatcgcgacccggctgcatttcggg
ctcacccatggaaatgccgcgctcgctgctgcgcaagaaacctgggctggcaccttcgtc
accctgccgtggcgcgagctgcgctggcgagaggagctcaccggcggacggcaggtcgcc
gcgagcatcggccggcgcccgggaatcgaacttgctgaacttttcaacccgctgccgctg
gcgctcctcgtaccgaacgggagcatcacatcatga

DBGET integrated database retrieval system