KEGG   Azoarcus sp. KH32C: AZKH_2722Help
Entry
AZKH_2722         CDS       T02502                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aza  Azoarcus sp. KH32C
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZKH_2722
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_2722
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZKH_2722
   00680 Methane metabolism
    AZKH_2722
Enzymes [BR:aza01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZKH_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3082708..3085446
Genome map
AA seq 912 aa AA seqDB search
MSTDKDQALRDDIRLLGRLLGDTVRAREGEAVFDLVERIRRDSIRFRRDDDHGARHKLEA
ELDRLSREDTLHVVRAFSYFSHLANLAEDQHHIRRSRAHLIAGSAPREGSLAHAMNRAFD
TGLDASSLADFFATAHVVPVLTAHPTEVQRKSILNCQTAIARLLDQRDRMTLTPDELREN
GDALRRGVLTLWQTRMLRPAKLSVVDEVSNGLGYHDTTFLREVPRLYAAIEDELAGRDTH
LADHELPAFLQVGSWIGGDRDGNPFVTAEMLEQALAMQCERVLAHYLEELGIVASQLSLA
SLLVPASDELLALADASPDRSPHRSDEPYRRAVTGIRARLTATRQAIVGDTASSPSVEAY
VSPEQLSADLDVVHRSLVANGSGELARGRLRRIRRAVAVFGFHLAPIDLRQNSEVHERVV
AELFEVAQPGTRYQKLTESQRIALLLDELATPRPLNSPHYAYSDETASELAIFGMAREAH
RRYGPASVPNCIISKADSVSDMLEVTVLLKEAGLLDPRTATLAVNVIPLFETIADLQASG
PIMDRLFDLPAWKRLLASRERTQEVMLGYSDSNKDGGFLTSGWELYKAEIALVDVFRRHN
VRLRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGQIRLTEQGEVIGAKYGNPEVGRRNLE
VLVAATLEASLLSGKEAAPRADFLDAMDELSATAFRAYRALVYETEGFERYFRESTIVDE
IAQLNIGSRPASRKKTFAIEDLRAIPWVFSWSQCRLMLPGWYGFGAAVTDYVERHGQAGL
ERLQAMHREWPFFATLLSNMDMVLAKSDIAIASRYAGLVHDEALRDAIFPVIRAEHQATI
EALLRITGQRELLDANPLLKRSIRNRFPYLDPLNHVQVELLRRHREGADDERIRRGIHLS
INGIAAGLRNSG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgacaaggaccaggccctgcgcgacgacatccggctgctcggccggctgctg
ggcgacaccgtccgcgcccgcgagggcgaagccgtattcgacctcgtcgagcgcatccgc
cgcgactcgatccgcttccgccgcgacgacgatcatggcgcccgtcacaagctcgaagcc
gaactcgaccgcctgtcgcgcgaggacacgctgcacgtcgtccgcgccttcagctacttc
tcgcacctcgcgaatctcgcggaggaccagcaccacatccgccgctcgcgcgcccacctg
atcgccggctccgcgccccgcgaaggcagtctcgcgcacgcgatgaaccgcgccttcgac
actggtctcgatgcctcttcgctcgccgacttcttcgcgacggcgcacgtcgtgcccgtc
ctcaccgctcacccgaccgaagtccaaaggaagagcatcctcaactgccagaccgcgatc
gcgcgcctcctggatcagcgcgaccgcatgacgctgacgcctgacgagttgcgcgagaac
ggcgacgccctgcgccgcggcgtcctgacgctgtggcagacgcggatgctccgcccggcg
aagctctcggttgtcgacgaagtctcgaacgggctcggctaccacgacacgactttcctg
cgcgaagtgccgcgcctctacgctgcgatcgaggatgaactcgcagggcgcgacacccat
ctcgccgaccacgagctgcccgccttcctgcaagtcggcagctggatcggcggcgaccgc
gacggcaaccccttcgtcaccgccgagatgctcgaacaggcgctcgcgatgcagtgcgag
cgtgtgctcgcccattatctcgaagagctcggcatcgtcgcctcgcagctctcgctcgcc
tcgctcctcgtgcccgcctcggacgaactgctggcgctggccgacgcctcgcccgaccgc
tcgccccaccgcagcgacgaaccctaccgccgcgccgtcaccggcattcgcgcccgcctc
acggcaacacgacaggccatcgtcggcgacaccgcctcgtcgccctcggtcgaagcctac
gtcagccccgagcagctctcggctgacctcgacgtcgtccaccgctcgctcgtcgccaac
ggatcgggcgaactcgcccgcgggcgcctgcgccgcatccgtcgcgccgtcgcggtgttc
ggtttccacctcgccccgatcgacctgcgccagaactccgaagtgcacgagcgcgtcgtc
gccgagctcttcgaagtcgcccagccgggcacccgctaccagaagctcaccgaatcgcag
cgcattgccctgctcctcgacgaactcgccacgccgcggccgctgaactcgccgcactac
gcctattccgatgaaaccgcctccgaactcgcgattttcgggatggcgcgcgaggcgcat
cgccgctacggcccggcctcggtgccgaactgcatcatctcgaaggccgacagcgtctcg
gacatgctcgaagtaacggtgctgctgaaggaagcgggcctcctcgatccgcgcaccgcc
acgctcgccgtcaacgtgatcccgctcttcgaaaccatcgccgacctgcaggcgagcggc
ccgatcatggatcgcctcttcgaccttccggcctggaagcgcctcctcgcctcgcgcgaa
cggacgcaggaagtgatgctcggctattccgactcgaacaaggacggcggcttcctcact
tccggctgggagctctacaaggccgagatcgcgctggtcgacgtcttccgccgccacaac
gtgcgcctgcgcctcttccacggccgcggcggttccgtcgggcgcggcggcggtccgagc
taccaggcgatcctcgcccaacccggcggtgccgtgcagggccagatccgtctcaccgaa
cagggcgaagtcatcggcgccaagtatggaaaccccgaagtcggccgccgcaacctcgaa
gtcctcgtcgccgcgaccctcgaagcgagcctgctgtccggcaaggaagccgcgccgcgc
gcggatttcctcgatgcgatggacgagctttccgcgaccgccttccgcgcctatcgcgcg
ctcgtctatgagacggaaggcttcgagcgctacttccgcgaatcgaccatcgtcgacgag
atcgcgcagctcaacatcggctcacgcccggcctcgcgcaagaagaccttcgcgatcgag
gacctgcgtgcaatcccttgggtcttcagctggtcgcaatgccgcctgatgttgcccggc
tggtacggcttcggcgctgccgtcaccgactacgtcgagcgccatgggcaggccggcctc
gaacgcttgcaggcgatgcaccgcgagtggcccttcttcgcgaccctgctgtcgaacatg
gacatggtgctggcgaagagcgacatcgcgatcgcgagccgctacgcgggactcgtgcat
gacgaagcgctgcgcgacgcgatcttcccggtgatccgtgccgagcatcaggcgacgatc
gaagcgctgctgcgcatcaccggtcagcgcgaactgctcgacgccaatccgctcctcaag
cgctcgatccgcaatcgcttcccctatctcgatccgctcaaccacgtccaagtcgaactc
ctgcggcgtcaccgcgaaggcgccgacgacgaacgcatccgccgcggcatccacttgtcg
atcaacggcatcgcggctgggttgcggaacagcggataa

DBGET integrated database retrieval system